Western Blot (WB)
(Western Blot analysis of PPP1R1C expression in transfected 293T cell line by PPP1R1C polyclonal antibody. Lane 1: PPP1R1C transfected lysate (12.3kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human PPP1R1C Polyclonal Antibody | anti-PPP1R1C antibody
PPP1R1C (Protein Phosphatase 1 Regulatory Subunit 1C, Inhibitor-5 of Protein Phosphatase 1, IPP5) (HRP)
Gene Names
PPP1R1C; IPP5
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPP1R1C; Polyclonal Antibody; PPP1R1C (Protein Phosphatase 1 Regulatory Subunit 1C; Inhibitor-5 of Protein Phosphatase 1; IPP5) (HRP); anti-PPP1R1C antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PPP1R1C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-PPP1R1C antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PPP1R1C, aa1-109 (NP_001074014.1).
Immunogen Sequence
MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of PPP1R1C expression in transfected 293T cell line by PPP1R1C polyclonal antibody. Lane 1: PPP1R1C transfected lysate (12.3kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PPP1R1C expression in transfected 293T cell line by PPP1R1C polyclonal antibody. Lane 1: PPP1R1C transfected lysate (12.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PPP1R1C antibody
Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit (see PPP1CA; MIM 176875) and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation (Wang et al., 2008 [PubMed 18310074]).[supplied by OMIM].
Product Categories/Family for anti-PPP1R1C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory inhibitor subunit 1C
NCBI Official Symbol
PPP1R1C
NCBI Official Synonym Symbols
IPP5
NCBI Protein Information
protein phosphatase 1 regulatory subunit 1C
Protein Family
NCBI Description
Protein phosphatase-1 (PP1) is a major serine/threonine phosphatase that regulates a variety of cellular functions. PP1 consists of a catalytic subunit (see PPP1CA; MIM 176875) and regulatory subunits that determine the subcellular localization of PP1 or regulate its function. PPP1R1C belongs to a group of PP1 inhibitory subunits that are themselves regulated by phosphorylation (Wang et al., 2008 [PubMed 18310074]).[supplied by OMIM, Feb 2010]
Research Articles on PPP1R1C
Similar Products
Product Notes
The PPP1R1C (Catalog #AAA6390410) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP1R1C (Protein Phosphatase 1 Regulatory Subunit 1C, Inhibitor-5 of Protein Phosphatase 1, IPP5) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R1C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPP1R1C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP1R1C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
