Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPP1R13L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Rabbit PPP1R13L Polyclonal Antibody | anti-PPP1R13L antibody

PPP1R13L antibody - middle region

Gene Names
PPP1R13L; RAI; RAI4; IASPP; NKIP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPP1R13L; Polyclonal Antibody; PPP1R13L antibody - middle region; anti-PPP1R13L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLMNSGAVYALWDYSAEFGDELSFREGESVTVLRRDGPEETDWWWAALHG
Sequence Length
828
Applicable Applications for anti-PPP1R13L antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PPP1R13L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPP1R13L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-PPP1R13L Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Related Product Information for anti-PPP1R13L antibody
This is a rabbit polyclonal antibody against PPP1R13L. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53), whereas ASPP1 and ASPP2 are activators of p53. IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53; MIM 191170), whereas ASPP1 (MIM 606455) and ASPP2 (MIM 602143) are activators of p53.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-PPP1R13L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
relA-associated inhibitor
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory subunit 13 like
NCBI Official Symbol
PPP1R13L
NCBI Official Synonym Symbols
RAI; RAI4; IASPP; NKIP1
NCBI Protein Information
relA-associated inhibitor
UniProt Protein Name
RelA-associated inhibitor
Protein Family
UniProt Gene Name
PPP1R13L
UniProt Synonym Gene Names
IASPP; NKIP1; PPP1R13BL; RAI; Protein iASPP
UniProt Entry Name
IASPP_HUMAN

NCBI Description

IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53; MIM 191170), whereas ASPP1 (MIM 606455) and ASPP2 (MIM 602143) are activators of p53.[supplied by OMIM, Mar 2008]

Uniprot Description

PPP1R13L: an oncoprotein that interacts with and inhibits NF-kappaB, Sp1 and p53. Plays a central role in regulation of apoptosis and transcription. May inhibit p53 by preventing its association with ASPP1 or ASPP2, thereby suppressing the subsequent activation of apoptosis. Required for neuronal survival after axonal injury. Two alternatively spliced isoforms have been described. Isoform 1 is preferrentially found in the cytoplasm; isoform 2 is nuclear.

Protein type: Phosphatase, regulatory subunit; Apoptosis; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: intercellular bridge; cytoplasm; cell junction; nucleus

Molecular Function: identical protein binding; protein binding; transcription corepressor activity; transcription factor binding

Biological Process: transcription, DNA-dependent; apoptosis; multicellular organism growth; negative regulation of transcription from RNA polymerase II promoter; multicellular organismal homeostasis; embryonic camera-type eye development; post-embryonic development; cardiac muscle contraction; hair cycle

Research Articles on PPP1R13L

Similar Products

Product Notes

The PPP1R13L ppp1r13l (Catalog #AAA3204303) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP1R13L antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R13L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP1R13L ppp1r13l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLMNSGAVYA LWDYSAEFGD ELSFREGESV TVLRRDGPEE TDWWWAALHG. It is sometimes possible for the material contained within the vial of "PPP1R13L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.