Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPM1G antibody Titration: 1 ug/mLSample Type: Human Fetal Lung)

Rabbit anti-Human PPM1G Polyclonal Antibody | anti-PPM1G antibody

PPM1G Antibody - C-terminal region

Gene Names
PPM1G; PP2CG; PPP2CG; PP2CGAMMA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PPM1G; Polyclonal Antibody; PPM1G Antibody - C-terminal region; anti-PPM1G antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD
Sequence Length
546
Applicable Applications for anti-PPM1G antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PPM1G
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPM1G antibody Titration: 1 ug/mLSample Type: Human Fetal Lung)

Western Blot (WB) (WB Suggested Anti-PPM1G antibody Titration: 1 ug/mLSample Type: Human Fetal Lung)
Related Product Information for anti-PPM1G antibody
This is a rabbit polyclonal antibody against PPM1G. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression.
Product Categories/Family for anti-PPM1G antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60 kDa
NCBI Official Full Name
protein phosphatase 1G
NCBI Official Synonym Full Names
protein phosphatase, Mg2+/Mn2+ dependent 1G
NCBI Official Symbol
PPM1G
NCBI Official Synonym Symbols
PP2CG; PPP2CG; PP2CGAMMA
NCBI Protein Information
protein phosphatase 1G
UniProt Protein Name
Protein phosphatase 1G
Protein Family
UniProt Gene Name
PPM1G
UniProt Synonym Gene Names
PPM1C; PP2C-gamma
UniProt Entry Name
PPM1G_HUMAN

NCBI Description

The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. [provided by RefSeq, Apr 2010]

Uniprot Description

PPM1G: is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression. [provided by RefSeq, Apr 2010]

Protein type: Spliceosome; Protein phosphatase, Ser/Thr (non-receptor); EC 3.1.3.16; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2p23.3

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; metal ion binding; protein serine/threonine phosphatase activity

Biological Process: protein amino acid dephosphorylation; cell cycle arrest

Research Articles on PPM1G

Similar Products

Product Notes

The PPM1G ppm1g (Catalog #AAA3219912) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPM1G Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPM1G can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPM1G ppm1g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NMTCIIICFK PRNTAELQPE SGKRKLEEVL STEGAEENGN SDKKKKAKRD. It is sometimes possible for the material contained within the vial of "PPM1G, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.