Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPIL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Rabbit anti-Human PPIL3 Polyclonal Antibody | anti-PPIL3 antibody

PPIL3 antibody - middle region

Gene Names
PPIL3; CYPJ
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPIL3; Polyclonal Antibody; PPIL3 antibody - middle region; anti-PPIL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK
Sequence Length
165
Applicable Applications for anti-PPIL3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PPIL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPIL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-PPIL3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Spleen)
Related Product Information for anti-PPIL3 antibody
This is a rabbit polyclonal antibody against PPIL3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events
Product Categories/Family for anti-PPIL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase-like 3 isoform PPIL3a
NCBI Official Synonym Full Names
peptidylprolyl isomerase like 3
NCBI Official Symbol
PPIL3
NCBI Official Synonym Symbols
CYPJ
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase-like 3
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase-like 3
UniProt Gene Name
PPIL3
UniProt Synonym Gene Names
PPIase; CyPJ
UniProt Entry Name
PPIL3_HUMAN

NCBI Description

This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2008]

Uniprot Description

PPIL3: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing. Belongs to the cyclophilin-type PPIase family. PPIL3 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cyclophilin; EC 5.2.1.8; Isomerase; Spliceosome

Chromosomal Location of Human Ortholog: 2q33.1

Molecular Function: protein binding; peptidyl-prolyl cis-trans isomerase activity

Biological Process: nuclear mRNA splicing, via spliceosome; protein peptidyl-prolyl isomerization; protein folding

Research Articles on PPIL3

Similar Products

Product Notes

The PPIL3 ppil3 (Catalog #AAA3210232) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPIL3 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPIL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPIL3 ppil3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGVQWRDLGS LQPPPPGFKQ VFCLSLPRTG RGGNSIWGKK FEDEYSEYLK. It is sometimes possible for the material contained within the vial of "PPIL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.