Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPIH Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysatePPIH is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit PPIH Polyclonal Antibody | anti-PPIH antibody

PPIH antibody - middle region

Gene Names
PPIH; CYPH; CYP-20; USA-CYP; SnuCyp-20
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPIH; Polyclonal Antibody; PPIH antibody - middle region; anti-PPIH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN
Sequence Length
177
Applicable Applications for anti-PPIH antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 90%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PPIH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPIH Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysatePPIH is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-PPIH Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysatePPIH is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-PPIH antibody
This is a rabbit polyclonal antibody against PPIH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.
Product Categories/Family for anti-PPIH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase H isoform 1
NCBI Official Synonym Full Names
peptidylprolyl isomerase H
NCBI Official Symbol
PPIH
NCBI Official Synonym Symbols
CYPH; CYP-20; USA-CYP; SnuCyp-20
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase H
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase H
UniProt Gene Name
PPIH
UniProt Synonym Gene Names
CYP20; CYPH; PPIase H; CypH; USA-CYP
UniProt Entry Name
PPIH_HUMAN

NCBI Description

The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome. [provided by RefSeq, Jul 2008]

Uniprot Description

PPIH: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex. May act as a chaperone. Belongs to the cyclophilin-type PPIase family. PPIase H subfamily.

Protein type: Cyclophilin; Isomerase; RNA processing; Spliceosome; EC 5.2.1.8

Chromosomal Location of Human Ortholog: 1p34.1

Cellular Component: spliceosome; U4/U6 x U5 tri-snRNP complex; cytoplasm; nuclear speck

Molecular Function: ribonucleoprotein binding; protein binding; peptidyl-prolyl cis-trans isomerase activity; cyclosporin A binding

Biological Process: nuclear mRNA splicing, via spliceosome; protein peptidyl-prolyl isomerization; positive regulation of viral genome replication; protein folding; protein complex assembly

Research Articles on PPIH

Similar Products

Product Notes

The PPIH ppih (Catalog #AAA3210639) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPIH antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PPIH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPIH ppih for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DFMIQGGDFV NGDGTGVASI YRGPFADENF KLRHSAPGLL SMANSGPSTN. It is sometimes possible for the material contained within the vial of "PPIH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.