Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PPFIBP1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 2ug/ml)

Rabbit anti-Human PPFIBP1 Polyclonal Antibody | anti-PPFIBP1 antibody

PPFIBP1 Antibody-N-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPFIBP1; Polyclonal Antibody; PPFIBP1 Antibody-N-terminal region; Liprin-beta-1; VCP; TP53; CDKN1A; CEP76; CEP250; LATS2; YWHAQ; YWHAB; UBC; GRK5; SH3KBP1; ELAVL1; YWHAG; S100A4; PPFIA1; PPFIA3; PPFIA2; PTPRM; SFN; L2; SGT2; hSGT2; hSgt2p; anti-PPFIBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
TLVEWLQSQMTNGHLPGNGDVYQERLARLENDKESLVLQVSVLTDQVEAQ
Applicable Applications for anti-PPFIBP1 antibody
Western Blot (WB)
Protein Size
1011 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PPFIBP1
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PPFIBP1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 2ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PPFIBP1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 2ug/ml)
Related Product Information for anti-PPFIBP1 antibody
Description of Target: The protein encoded by this gene is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis. In vitro experiment demonstrated that the interaction inhibited the phosphorylation of this protein by protein kinase C and protein kinase CK2. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
111kDa
UniProt Protein Name
Liprin-beta-1
Protein Family
UniProt Gene Name
PPFIBP1
UniProt Synonym Gene Names
KIAA1230; PTPRF-interacting protein-binding protein 1
UniProt Entry Name
LIPB1_HUMAN

Uniprot Description

liprin beta 1: a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis. In vitro experiment demonstrated that the interaction inhibited the phosphorylation of this protein by protein kinase C and protein kinase CK2. Five alternatively spliced isoforms have been described.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 12p12.1

Cellular Component: focal adhesion; plasma membrane

Biological Process: cell adhesion

Similar Products

Product Notes

The PPFIBP1 ppfibp1 (Catalog #AAA3249606) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPFIBP1 Antibody-N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPFIBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPFIBP1 ppfibp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TLVEWLQSQM TNGHLPGNGD VYQERLARLE NDKESLVLQV SVLTDQVEAQ. It is sometimes possible for the material contained within the vial of "PPFIBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.