Western Blot (WB)
(PPAP2A rabbit polyclonal antibody. Western Blot analysis of PPAP2A expression in human pancreas.)
Rabbit anti-Human PPAP2A Polyclonal Antibody | anti-ppap2a antibody
PPAP2A (Lipid Phosphate Phosphohydrolase 1, PAP2-alpha, Phosphatidate Phosphohydrolase Type 2a, Phosphatidic Acid Phosphatase 2a, PAP-2a, PAP2a, LPP1)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PPAP2A; Polyclonal Antibody; PPAP2A (Lipid Phosphate Phosphohydrolase 1; PAP2-alpha; Phosphatidate Phosphohydrolase Type 2a; Phosphatidic Acid Phosphatase 2a; PAP-2a; PAP2a; LPP1); Anti -PPAP2A (Lipid Phosphate Phosphohydrolase 1; anti-ppap2a antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PPAP2A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYKAIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPTLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFFKERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP
Applicable Applications for anti-ppap2a antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PPAP2A, aa1-284 (NP_003702.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(PPAP2A rabbit polyclonal antibody. Western Blot analysis of PPAP2A expression in human pancreas.)
Western Blot (WB)
(PPAP2A rabbit polyclonal antibody. Western Blot analysis of PPAP2A expression in human pancreas.)
Western Blot (WB)
(PPAP2A rabbit polyclonal antibody. Western Blot analysis of PPAP2A expression in K-562.)
Western Blot (WB)
(PPAP2A rabbit polyclonal antibody. Western Blot analysis of PPAP2A expression in K-562.)
Western Blot (WB)
(Western Blot analysis of PPAP2A expression in transfected 293T cell line by PPAP2A polyclonal antibody. Lane 1: PPAP2A transfected lysate (32.2kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PPAP2A expression in transfected 293T cell line by PPAP2A polyclonal antibody. Lane 1: PPAP2A transfected lysate (32.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ppap2a antibody
Broad-specificity phosphohydrolase that dephosphorylates exogenous bioactive glycerolipids and sphingolipids. Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). Pivotal regulator of lysophosphatidic acid (LPA) signaling in the cardiovascular system. Major enzyme responsible of dephosphorylating LPA in platelets, which terminates signaling actions of LPA. May control circulating, and possibly also regulate localized, LPA levels resulting from platelet activation. It has little activity towards ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P). The relative catalytic efficiency is LPA > PA > S-1-P > C-1-P. It's down-regulation may contribute to the development of colon adenocarcinoma.
Product Categories/Family for anti-ppap2a antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The ppap2a (Catalog #AAA6009161) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPAP2A (Lipid Phosphate Phosphohydrolase 1, PAP2-alpha, Phosphatidate Phosphohydrolase Type 2a, Phosphatidic Acid Phosphatase 2a, PAP-2a, PAP2a, LPP1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPAP2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the ppap2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MFDKTRLPYV ALDVLCVLLA GLPFAILTSR HTPFQRGVFC NDESIKYPYK EDTIPYALLG GIIIPFSIIV IILGETLSVY CNLLHSNSFI RNNYIATIYK AIGTFLFGAA ASQSLTDIAK YSIGRLRPHF LDVCDPDWSK INCSDGYIEY YICRGNAERV KEGRLSFYSG HSSFSMYCML FVALYLQARM KGDWARLLRP TLQFGLVAVS IYVGLSRVSD YKHHWSDVLT GLIQGALVAI LVAVYVSDFF KERTSFKERK EEDSHTTLHE TPTTGNHYPS NHQP. It is sometimes possible for the material contained within the vial of "PPAP2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
