Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-PPA2 Polyclonal Antibody)

Rabbit PPA2 Polyclonal Antibody | anti-PPA2 antibody

PPA2 Polyclonal Antibody

Gene Names
PPA2; SCFI; SCFAI; HSPC124; SID6-306
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purification
Synonyms
PPA2; Polyclonal Antibody; PPA2 Polyclonal Antibody; HSPC124; SCFAI; SCFI; SID6-306; pyrophosphatase (inorganic) 2; anti-PPA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.27 mg/ml (varies by lot)
Sequence Length
305
Applicable Applications for anti-PPA2 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:100
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 33-100 of human PPA2 (NP_008834.3).
Immunogen Sequence
ALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEENGIPMKKARNDEYENLFNMIVEIPR
Positive Samples
U-251MG, A-549, OVCAR3
Cellular Location
Mitochondrion
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-PPA2 Polyclonal Antibody)

Western Blot (WB) (Western blot-PPA2 Polyclonal Antibody)
Related Product Information for anti-PPA2 antibody
The protein encoded by this gene is localized to the mitochondrion, is highly similar to members of the inorganic pyrophosphatase (PPase) family, and contains the signature sequence essential for the catalytic activity of PPase. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 18kDa; 25kDa; 34kDa; 37kDa; 39kDa
Observed: 38kDa
NCBI Official Full Name
inorganic pyrophosphatase 2, mitochondrial isoform 2
NCBI Official Synonym Full Names
pyrophosphatase (inorganic) 2
NCBI Official Symbol
PPA2
NCBI Official Synonym Symbols
SCFI; SCFAI; HSPC124; SID6-306
NCBI Protein Information
inorganic pyrophosphatase 2, mitochondrial
UniProt Protein Name
Inorganic pyrophosphatase 2, mitochondrial
UniProt Gene Name
PPA2
UniProt Synonym Gene Names
PPase 2
UniProt Entry Name
IPYR2_HUMAN

NCBI Description

The protein encoded by this gene is localized to the mitochondrion, is highly similar to members of the inorganic pyrophosphatase (PPase) family, and contains the signature sequence essential for the catalytic activity of PPase. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

PPA2: is localized to the mitochondrion, is highly similar to members of the inorganic pyrophosphatase (PPase) family, and contains the signature sequence essential for the catalytic activity of PPase. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Protein type: EC 3.6.1.1; Energy Metabolism - oxidative phosphorylation; Hydrolase; Mitochondrial

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: mitochondrial matrix

Molecular Function: inorganic diphosphatase activity

Biological Process: tRNA aminoacylation for protein translation

Disease: Sudden Cardiac Failure, Alcohol-induced; Sudden Cardiac Failure, Infantile

Research Articles on PPA2

Similar Products

Product Notes

The PPA2 ppa2 (Catalog #AAA9140530) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPA2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PPA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:100 IF: 1:50-1:100. Researchers should empirically determine the suitability of the PPA2 ppa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.