Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using PON3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

Rabbit anti-Human PON3 Polyclonal Antibody | anti-PON3 antibody

PON3 Rabbit pAb

Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
PON3; Polyclonal Antibody; PON3 Rabbit pAb; anti-PON3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
HDNWDLTQLKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTL
Applicable Applications for anti-PON3 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 250-350 of human PON3 (NP_000931.1).
Cellular Location
Secreted, extracellular space
Positive Samples
Jurkat, HepG2
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using PON3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using PON3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)
Related Product Information for anti-PON3 antibody
Background: This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). The protein also rapidly hydrolyzes lactones and can inhibit the oxidation of low-density lipoprotein (LDL), a function that is believed to slow the initiation and progression of atherosclerosis. Alternatively spliced variants which encode different protein isoforms have been described; however, only one has been fully characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,607 Da
NCBI Official Full Name
serum paraoxonase/lactonase 3
NCBI Official Synonym Full Names
paraoxonase 3
NCBI Official Symbol
PON3
NCBI Protein Information
serum paraoxonase/lactonase 3; paraoxanase-3; arylesterase 3
UniProt Protein Name
Serum paraoxonase/lactonase 3
UniProt Gene Name
PON3
UniProt Entry Name
PON3_HUMAN

NCBI Description

This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). The protein also rapidly hydrolyzes lactones and can inhibit the oxidation of low-density lipoprotein (LDL), a function that is believed to slow the initiation and progression of atherosclerosis. Alternatively spliced variants which encode different protein isoforms have been described; however, only one has been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

PON3: Has low activity towards the organophosphate paraxon and aromatic carboxylic acid esters. Rapidly hydrolyzes lactones such as statin prodrugs (e.g. lovastatin). Hydrolyzes aromatic lactones and 5- or 6-member ring lactones with aliphatic substituents but not simple lactones or those with polar substituents. Belongs to the paraoxonase family.

Protein type: Hydrolase; EC 3.1.1.2; Secreted; EC 3.1.8.1; Secreted, signal peptide; EC 3.1.1.81

Chromosomal Location of Human Ortholog: 7q21.3

Cellular Component: extracellular space; intracellular membrane-bound organelle

Molecular Function: protein homodimerization activity; 3,4-dihydrocoumarin hydrolase activity; dihydrocoumarin hydrolase activity; arylesterase activity; metal ion binding; aryldialkylphosphatase activity

Biological Process: response to external stimulus; dephosphorylation; coumarin catabolic process; carboxylic acid catabolic process; aromatic compound catabolic process; phenylacetate catabolic process

Research Articles on PON3

Similar Products

Product Notes

The PON3 pon3 (Catalog #AAA9142313) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PON3 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PON3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PON3 pon3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HDNWDLTQLK VIQLGTLVDN LTVDPATGDI LAGCHPNPMK LLNYNPEDPP GSEVLRIQNV LSEKPRVSTV YANNGSVLQG TSVASVYHGK ILIGTVFHKT L. It is sometimes possible for the material contained within the vial of "PON3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.