Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: POLRMTSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Rabbit POLRMT Polyclonal Antibody | anti-POLRMT antibody

POLRMT Antibody - C-terminal region

Gene Names
POLRMT; APOLMT; MTRNAP; MTRPOL; h-mtRPOL
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLRMT; Polyclonal Antibody; POLRMT Antibody - C-terminal region; anti-POLRMT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALGRDSVGAASVNLEPSDVPQDVYSGVAAQVEVFRRQDAQRGMRVAQVLE
Sequence Length
1230
Applicable Applications for anti-POLRMT antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 77%; Rat: 92%; Yeast: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human POLRMT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: POLRMTSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: POLRMTSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: POLRMTSample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/mlPOLRMT is supported by BioGPS gene expression data to be expressed in OVCAR3)

Western Blot (WB) (Host: RabbitTarget Name: POLRMTSample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/mlPOLRMT is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-POLRMT antibody
This is a rabbit polyclonal antibody against POLRMT. It was validated on Western Blot

Target Description: This gene encodes a mitochondrial DNA-directed RNA polymerase. The gene product is responsible for mitochondrial gene expression as well as for providing RNA primers for initiation of replication of the mitochondrial genome. Although this polypeptide has the same function as the three nuclear DNA-directed RNA polymerases, it is more closely related to RNA polymerases of phage and mitochondrial polymerases of lower eukaryotes.
Product Categories/Family for anti-POLRMT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
135kDa
NCBI Official Full Name
DNA-directed RNA polymerase, mitochondrial
NCBI Official Synonym Full Names
RNA polymerase mitochondrial
NCBI Official Symbol
POLRMT
NCBI Official Synonym Symbols
APOLMT; MTRNAP; MTRPOL; h-mtRPOL
NCBI Protein Information
DNA-directed RNA polymerase, mitochondrial
UniProt Protein Name
DNA-directed RNA polymerase, mitochondrial
UniProt Gene Name
POLRMT
UniProt Synonym Gene Names
MtRPOL
UniProt Entry Name
RPOM_HUMAN

NCBI Description

This gene encodes a mitochondrial DNA-directed RNA polymerase. The gene product is responsible for mitochondrial gene expression as well as for providing RNA primers for initiation of replication of the mitochondrial genome. Although this polypeptide has the same function as the three nuclear DNA-directed RNA polymerases, it is more closely related to RNA polymerases of phage and mitochondrial polymerases of lower eukaryotes. [provided by RefSeq, Jul 2008]

Research Articles on POLRMT

Similar Products

Product Notes

The POLRMT polrmt (Catalog #AAA3209110) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLRMT Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's POLRMT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLRMT polrmt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALGRDSVGAA SVNLEPSDVP QDVYSGVAAQ VEVFRRQDAQ RGMRVAQVLE. It is sometimes possible for the material contained within the vial of "POLRMT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.