Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:Lane1: 50 ug mouse heptoma cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:PORL1ESubmitted by:Eekjoong Park, UCSD)

Rabbit POLR1E Polyclonal Antibody | anti-POLR1E antibody

POLR1E antibody - N-terminal region

Gene Names
POLR1E; PAF53; PRAF1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLR1E; Polyclonal Antibody; POLR1E antibody - N-terminal region; anti-POLR1E antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYVGNNFGTGALKCNTL
Sequence Length
419
Applicable Applications for anti-POLR1E antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human POLR1E
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane1: 50 ug mouse heptoma cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:PORL1ESubmitted by:Eekjoong Park, UCSD)

Western Blot (WB) (Lanes:Lane1: 50 ug mouse heptoma cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:PORL1ESubmitted by:Eekjoong Park, UCSD)

Western Blot (WB)

(Researcher: Eekjoong Park, UCSDApplication: Western blottingSpecies + Tissue/Cell type: Mouse heptoma cell lysateHow many ug's of tissue/cell lysate run on the gel:1: 50 ug mouse heptoma cell lysatePrimary antibody dilution: 1:1000Secondary antibody: Anti-rabbit HRPSecondary antibody dilution: 1:5000)

Western Blot (WB) (Researcher: Eekjoong Park, UCSDApplication: Western blottingSpecies + Tissue/Cell type: Mouse heptoma cell lysateHow many ug's of tissue/cell lysate run on the gel:1: 50 ug mouse heptoma cell lysatePrimary antibody dilution: 1:1000Secondary antibody: Anti-rabbit HRPSecondary antibody dilution: 1:5000)

Western Blot (WB)

(WB Suggested Anti-POLR1E Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-POLR1E Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Related Product Information for anti-POLR1E antibody
This is a rabbit polyclonal antibody against POLR1E. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: POLR1E is a DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.POLR1E is the component of RNA polymerase I which synthesizes ribosomal RNA precursors.POLR1E appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF.
Product Categories/Family for anti-POLR1E antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
DNA-directed RNA polymerase I subunit RPA49 isoform 1
NCBI Official Synonym Full Names
RNA polymerase I subunit E
NCBI Official Symbol
POLR1E
NCBI Official Synonym Symbols
PAF53; PRAF1
NCBI Protein Information
DNA-directed RNA polymerase I subunit RPA49
UniProt Protein Name
DNA-directed RNA polymerase I subunit RPA49
UniProt Gene Name
POLR1E
UniProt Synonym Gene Names
PAF53; PRAF1; RNA polymerase I subunit A49
UniProt Entry Name
RPA49_HUMAN

Uniprot Description

POLR1E: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Appears to be involved in the formation of the initiation complex at the promoter by mediating the interaction between Pol I and UBTF/UBF. Belongs to the eukaryotic RPA49/POLR1E RNA polymerase subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Nucleotide Metabolism - pyrimidine; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 9p13.2

Cellular Component: nucleoplasm; nucleolus; nucleus; DNA-directed RNA polymerase I complex

Molecular Function: DNA binding

Biological Process: negative regulation of gene expression, epigenetic; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; gene expression; termination of RNA polymerase I transcription; transcription initiation from RNA polymerase I promoter; regulation of gene expression, epigenetic; rRNA transcription

Research Articles on POLR1E

Similar Products

Product Notes

The POLR1E polr1e (Catalog #AAA3213474) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR1E antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's POLR1E can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLR1E polr1e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPGNMRFTLY ENKDSTNPRK RNQRILAAET DRLSYVGNNF GTGALKCNTL. It is sometimes possible for the material contained within the vial of "POLR1E, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.