Western Blot (WB)
(WB Suggested Anti-POGK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Rabbit POGK Polyclonal Antibody | anti-POGK antibody
POGK antibody - N-terminal region
Gene Names
POGK; BASS2; KRBOX2; LST003
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POGK; Polyclonal Antibody; POGK antibody - N-terminal region; anti-POGK antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MESTAYPLNLSLKEEEEEEEIQSRELEDGPADMQKVRICSEGGWVPALFD
Sequence Length
609
Applicable Applications for anti-POGK antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 91%; Rat: 92%; Yeast: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human POGK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-POGK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-POGK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-POGK antibody
This is a rabbit polyclonal antibody against POGK. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The exact function of the protein encoded by this gene is not known. However, POGK contains a KRAB domain (which is involved in protein-protein interactions) at the N-terminus, and a transposase domain at the C-terminus, suggesting that it may belong to t
Target Description: The exact function of the protein encoded by this gene is not known. However, POGK contains a KRAB domain (which is involved in protein-protein interactions) at the N-terminus, and a transposase domain at the C-terminus, suggesting that it may belong to t
Product Categories/Family for anti-POGK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69kDa
NCBI Official Full Name
pogo transposable element with KRAB domain isoform 1
NCBI Official Synonym Full Names
pogo transposable element derived with KRAB domain
NCBI Official Symbol
POGK
NCBI Official Synonym Symbols
BASS2; KRBOX2; LST003
NCBI Protein Information
pogo transposable element with KRAB domain
UniProt Protein Name
Pogo transposable element with KRAB domain
Protein Family
UniProt Gene Name
POGK
UniProt Synonym Gene Names
KIAA1513
NCBI Description
The exact function of the protein encoded by this gene is not known. However, this gene product contains a KRAB domain (which is involved in protein-protein interactions) at the N-terminus, and a transposase domain at the C-terminus, suggesting that it may belong to the family of DNA-mediated transposons in human. [provided by RefSeq, Jul 2008]
Uniprot Description
POGK:
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 1q24.1
Cellular Component: nucleus
Molecular Function: DNA binding; protein binding
Biological Process: multicellular organism development; regulation of transcription, DNA-templated
Research Articles on POGK
Similar Products
Product Notes
The POGK pogk (Catalog #AAA3204538) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POGK antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's POGK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POGK pogk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MESTAYPLNL SLKEEEEEEE IQSRELEDGP ADMQKVRICS EGGWVPALFD. It is sometimes possible for the material contained within the vial of "POGK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
