Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PNPO expression in transfected 293T cell line by PNPO polyclonal antibody. Lane 1: PNPO transfected lysate (30kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PNPO Polyclonal Antibody | anti-PNPO antibody

PNPO (Pyridoxine-5'-phosphate Oxidase, Pyridoxamine-phosphate Oxidase, FLJ10535, PDXPO) (FITC)

Gene Names
PNPO; PDXPO; HEL-S-302
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PNPO; Polyclonal Antibody; PNPO (Pyridoxine-5'-phosphate Oxidase; Pyridoxamine-phosphate Oxidase; FLJ10535; PDXPO) (FITC); anti-PNPO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PNPO.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-PNPO antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PNPO, aa1-261 (NP_060599.1).
Immunogen Sequence
MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PNPO expression in transfected 293T cell line by PNPO polyclonal antibody. Lane 1: PNPO transfected lysate (30kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PNPO expression in transfected 293T cell line by PNPO polyclonal antibody. Lane 1: PNPO transfected lysate (30kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PNPO antibody
The enzyme encoded by this gene catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine.
Product Categories/Family for anti-PNPO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,200 Da
NCBI Official Full Name
pyridoxine-5'-phosphate oxidase
NCBI Official Synonym Full Names
pyridoxamine 5'-phosphate oxidase
NCBI Official Symbol
PNPO
NCBI Official Synonym Symbols
PDXPO; HEL-S-302
NCBI Protein Information
pyridoxine-5'-phosphate oxidase; epididymis secretory protein Li 302; pyridoxal 5'-phosphate synthase; pyridoxamine-phosphate oxidase; pyridoxine 5'-phosphate oxidase
UniProt Protein Name
Pyridoxine-5'-phosphate oxidase
UniProt Gene Name
PNPO
UniProt Entry Name
PNPO_HUMAN

NCBI Description

The enzyme encoded by this gene catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine. Mutations in this gene result in pyridoxamine 5'-phosphate oxidase (PNPO) deficiency, a form of neonatal epileptic encephalopathy. [provided by RefSeq, Oct 2008]

Uniprot Description

PNPO: Catalyzes the oxidation of either pyridoxine 5'- phosphate (PNP) or pyridoxamine 5'-phosphate (PMP) into pyridoxal 5'-phosphate (PLP). Defects in PNPO are the cause of pyridoxine-5'-phosphate oxidase deficiency (PNPO deficiency); also known as PNPO-related neonatal epileptic encephalopathy. The main feature of neonatal epileptic encephalopathy is the onset within hours of birth of a severe seizure disorder that does not respond to anticonvulsant drugs and can be fatal. Seizures can cease with the administration of PLP, being resistant to treatment with pyridoxine. Belongs to the pyridoxamine 5'-phosphate oxidase family.

Protein type: Cofactor and Vitamin Metabolism - vitamin B6; EC 1.4.3.5; Oxidoreductase

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: FMN binding; pyridoxamine-phosphate oxidase activity

Biological Process: vitamin metabolic process; vitamin B6 metabolic process; pyridoxine biosynthetic process; water-soluble vitamin metabolic process; pyridoxal phosphate biosynthetic process

Disease: Pyridoxamine 5-prime-phosphate Oxidase Deficiency

Research Articles on PNPO

Similar Products

Product Notes

The PNPO pnpo (Catalog #AAA6390024) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PNPO (Pyridoxine-5'-phosphate Oxidase, Pyridoxamine-phosphate Oxidase, FLJ10535, PDXPO) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PNPO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PNPO pnpo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PNPO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.