Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- PLN Picoband antibody, MBS178013, Western blottingAll lanes: Anti PLN (MBS178013) at 0.5ug/mlLane 1: Mouse Cardiac Muscle Tissue Lysate at 50ugLane 2: Rat Cardiac Muscle Tissue Lysate at 50ugLane 3: COLO320 Whole Cell Lysate at 40ugLane 4: K562 Whole Cell Lysate at 40ugPredicted bind size: 6KDObserved bind size: 18, 24, 36KD )

PLN Polyclonal Antibody | anti-PLN antibody

Anti-PLN Antibody

Gene Names
PLN; PLB; CMD1P; CMH18
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
PLN; Polyclonal Antibody; Anti-PLN Antibody; Cardiac phospholamban; CMD1P; CMH18; PLB; PPLA_HUMAN; phospholamban; anti-PLN antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
52
Applicable Applications for anti-PLN antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human PLN(1-35aa MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- PLN Picoband antibody, MBS178013, Western blottingAll lanes: Anti PLN (MBS178013) at 0.5ug/mlLane 1: Mouse Cardiac Muscle Tissue Lysate at 50ugLane 2: Rat Cardiac Muscle Tissue Lysate at 50ugLane 3: COLO320 Whole Cell Lysate at 40ugLane 4: K562 Whole Cell Lysate at 40ugPredicted bind size: 6KDObserved bind size: 18, 24, 36KD )

Western Blot (WB) (Anti- PLN Picoband antibody, MBS178013, Western blottingAll lanes: Anti PLN (MBS178013) at 0.5ug/mlLane 1: Mouse Cardiac Muscle Tissue Lysate at 50ugLane 2: Rat Cardiac Muscle Tissue Lysate at 50ugLane 3: COLO320 Whole Cell Lysate at 40ugLane 4: K562 Whole Cell Lysate at 40ugPredicted bind size: 6KDObserved bind size: 18, 24, 36KD )
Related Product Information for anti-PLN antibody
Description: Rabbit IgG polyclonal antibody for Cardiac phospholamban(PLN) detection. Tested with WB in Human;Mouse;Rat.

Background: Phospholamban is a 52 amino acid integral membrane protein that regulates the Ca2+ pump in cardiac muscle and skeletal muscle cells. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. Phospholamban is also expressed in slow-twitch skeletal muscle and some smooth muscle cells. It is observed that human ventricle and quadriceps displayed high levels of phospholamban transcripts and proteins, with markedly lower expression observed in smooth muscles, while the right atrium also expressed low levels of phospholamban. The structure of the human phospholamban gene closely resembles that reported for chicken, rabbit, rat, and mouse. Comparison of the human to other mammalian phospholamban genes indicated a marked conservation of sequence for at least 217 bp upstream of the transcription start site.
References
1. Rodriguez P, Kranias EG (December 2005). "Phospholamban: a key determinant of cardiac function and dysfunction". Arch Mal Coeur Vaiss 98 (12): 1239-43. 2. McTiernan, C. F.; Frye, C. S.; Lemster, B. H.; Kinder, E. A.; Ogletree-Hughes, M. L.; Moravec, C. S.; Feldman, A. M. : The human phospholamban gene: structure and expression. J. Molec. Cell Cardiol. 31: 679-692, 1999.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
6,109 Da
NCBI Official Full Name
cardiac phospholamban
NCBI Official Synonym Full Names
phospholamban
NCBI Official Symbol
PLN
NCBI Official Synonym Symbols
PLB; CMD1P; CMH18
NCBI Protein Information
cardiac phospholamban
UniProt Protein Name
Cardiac phospholamban
Protein Family
UniProt Gene Name
PLN
UniProt Synonym Gene Names
PLB; PLB
UniProt Entry Name
PPLA_HUMAN

NCBI Description

The protein encoded by this gene is found as a pentamer and is a major substrate for the cAMP-dependent protein kinase in cardiac muscle. The encoded protein is an inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation of the protein. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. The encoded protein is a key regulator of cardiac diastolic function. Mutations in this gene are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure, and also familial hypertrophic cardiomyopathy. [provided by RefSeq, Apr 2016]

Uniprot Description

PLB: a heart protein postulated to regulate the activity of the calcium pump of cardiac sarcoplasmic reticulum. A major substrate for the cAMP-dependent protein kinase. An inhibitor of cardiac muscle sarcoplasmic reticulum Ca(2+)-ATPase in the unphosphorylated state, but inhibition is relieved upon phosphorylation. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. A key regulator of cardiac diastolic function. Mutations are a cause of inherited human dilated cardiomyopathy with refractory congestive heart failure.

Protein type: Membrane protein, integral; Inhibitor

Chromosomal Location of Human Ortholog: 6q22.1

Cellular Component: endoplasmic reticulum; membrane; mitochondrial membrane; mitochondrion; perinuclear region of cytoplasm; sarcoplasmic reticulum membrane; vesicle

Molecular Function: ATPase binding; ATPase inhibitor activity; calcium channel regulator activity; enzyme inhibitor activity; identical protein binding; protein binding

Biological Process: blood circulation; calcium ion transport; cardiac muscle development; cytosolic calcium ion homeostasis; negative regulation of ATPase activity; negative regulation of calcium ion transport; negative regulation of catalytic activity; negative regulation of heart rate; Notch signaling pathway; protein homooligomerization; regulation of calcium ion transport; regulation of heart contraction; regulation of the force of heart contraction; response to insulin stimulus; response to testosterone stimulus; response to zinc ion

Disease: Cardiomyopathy, Dilated, 1p; Cardiomyopathy, Familial Hypertrophic, 18

Research Articles on PLN

Similar Products

Product Notes

The PLN pln (Catalog #AAA178013) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-PLN Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PLN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the PLN pln for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.