Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PLIN Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Rabbit PLIN Polyclonal Antibody | anti-PLIN1 antibody

PLIN antibody - N-terminal region

Gene Names
PLIN1; PERI; PLIN; FPLD4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
PLIN; Polyclonal Antibody; PLIN antibody - N-terminal region; anti-PLIN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS
Sequence Length
522
Applicable Applications for anti-PLIN1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PLIN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PLIN Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-PLIN Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-PLIN1 antibody
This is a rabbit polyclonal antibody against PLIN. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.The protein encoded by this gene coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The encoded protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.
Product Categories/Family for anti-PLIN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
perilipin-1
NCBI Official Synonym Full Names
perilipin 1
NCBI Official Symbol
PLIN1
NCBI Official Synonym Symbols
PERI; PLIN; FPLD4
NCBI Protein Information
perilipin-1
UniProt Protein Name
Perilipin-1
Protein Family
UniProt Gene Name
PLIN1
UniProt Synonym Gene Names
PERI; PLIN
UniProt Entry Name
PLIN1_HUMAN

NCBI Description

The protein encoded by this gene coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The encoded protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis. Alternatively spliced transcript variants varying in the 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Feb 2009]

Uniprot Description

perilipin 1: an adipocyte protein of the peripilin family. A modulator of adipocyte lipid metabolism, coating lipid storage droplets to protect them from being broken down by hormone-sensitive lipase. A major cAMP-dependent protein kinase-substrate in adipocytes, also dephosphorylated by PP1. When phosphorylated, may be maximally sensitive to HSL and when unphosphorylated, may play a role in the inhibition of lipolysis.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 15q26

Cellular Component: endoplasmic reticulum; lipid particle; cytosol

Molecular Function: lipid binding

Biological Process: triacylglycerol catabolic process; lipid metabolic process

Disease: Lipodystrophy, Familial Partial, Type 4

Research Articles on PLIN1

Similar Products

Product Notes

The PLIN1 plin1 (Catalog #AAA3206175) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLIN antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PLIN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLIN1 plin1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STQFTAANEL ACRGLDHLEE KIPALQYPPE KIASELKDTI STRLRSARNS. It is sometimes possible for the material contained within the vial of "PLIN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.