Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PGF expression in transfected 293T cell line by PGF polyclonal antibody. Lane 1: PGF transfected lysate (19.3kD). Lane 2: Non-transfected lysate)

Rabbit anti-Human PLGF Polyclonal Antibody | anti-PLGF antibody

PLGF (Placenta Growth Factor, Placental Growth Factor, PGF, PGFL, D12S1900, PlGF-2, SHGC-10760) (AP)

Gene Names
PGF; PGFL; PLGF; PlGF-2; D12S1900; SHGC-10760
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLGF; Polyclonal Antibody; PLGF (Placenta Growth Factor; Placental Growth Factor; PGF; PGFL; D12S1900; PlGF-2; SHGC-10760) (AP); anti-PLGF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PGF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PLGF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PGF, aa1-170 (NP_002623.2).
Immunogen Sequence
MPVMRLFPCFLQLLAGLALPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PGF expression in transfected 293T cell line by PGF polyclonal antibody. Lane 1: PGF transfected lysate (19.3kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of PGF expression in transfected 293T cell line by PGF polyclonal antibody. Lane 1: PGF transfected lysate (19.3kD). Lane 2: Non-transfected lysate)

Testing Data

(Proximity Ligation Analysis of protein-protein interactions between PGF and VEGFA. HeLa cells were stained with PGF rabbit purified polyclonal 1:1200 and VEGFA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue))

Testing Data (Proximity Ligation Analysis of protein-protein interactions between PGF and VEGFA. HeLa cells were stained with PGF rabbit purified polyclonal 1:1200 and VEGFA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue))
Related Product Information for anti-PLGF antibody
Placenta growth factor belongs to the PDGF/VEGF growth factor family. It is a secreted N-glycosylated protein with roles in angiogenesis and endothelial cell growth. At least 3 isoforms are produced by alternative splicing; PIGF-1, PIGF-2 and PIGF-3.
Product Categories/Family for anti-PLGF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,789 Da
NCBI Official Full Name
placenta growth factor isoform 1
NCBI Official Synonym Full Names
placental growth factor
NCBI Official Symbol
PGF
NCBI Official Synonym Symbols
PGFL; PLGF; PlGF-2; D12S1900; SHGC-10760
NCBI Protein Information
placenta growth factor; placental growth factor, vascular endothelial growth factor-related protein
UniProt Protein Name
Placenta growth factor
UniProt Gene Name
PGF
UniProt Synonym Gene Names
PGFL; PLGF; PlGF
UniProt Entry Name
PLGF_HUMAN

Uniprot Description

PGF: Growth factor active in angiogenesis and endothelial cell growth, stimulating their proliferation and migration. It binds to the receptor FLT1/VEGFR-1. Isoform PlGF-2 binds NRP1/neuropilin-1 and NRP2/neuropilin-2 in a heparin-dependent manner. Also promotes cell tumor growth. Belongs to the PDGF/VEGF growth factor family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: extracellular space; membrane; extracellular region

Molecular Function: heparin binding; protein binding; protein homodimerization activity; growth factor activity; protein heterodimerization activity

Biological Process: response to drug; organ regeneration; female pregnancy; signal transduction; cellular response to hormone stimulus; positive regulation of angiogenesis; cell-cell signaling; ureteric bud branching; positive regulation of cell division; positive regulation of cell proliferation; response to hypoxia; positive regulation of endothelial cell proliferation; sprouting angiogenesis; vascular endothelial growth factor receptor signaling pathway; cell differentiation

Similar Products

Product Notes

The PLGF pgf (Catalog #AAA6389790) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLGF (Placenta Growth Factor, Placental Growth Factor, PGF, PGFL, D12S1900, PlGF-2, SHGC-10760) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLGF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLGF pgf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLGF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.