Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PLDN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)

Rabbit PLDN Polyclonal Antibody | anti-BLOC1S6 antibody

PLDN antibody - N-terminal region

Gene Names
BLOC1S6; PA; HPS9; PLDN; BLOS6; PALLID
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PLDN; Polyclonal Antibody; PLDN antibody - N-terminal region; anti-BLOC1S6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE
Sequence Length
172
Applicable Applications for anti-BLOC1S6 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 85%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PLDN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PLDN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-PLDN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)
Related Product Information for anti-BLOC1S6 antibody
This is a rabbit polyclonal antibody against PLDN. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.
Product Categories/Family for anti-BLOC1S6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
biogenesis of lysosome-related organelles complex 1 subunit 6 isoform 2
NCBI Official Synonym Full Names
biogenesis of lysosomal organelles complex 1 subunit 6
NCBI Official Symbol
BLOC1S6
NCBI Official Synonym Symbols
PA; HPS9; PLDN; BLOS6; PALLID
NCBI Protein Information
biogenesis of lysosome-related organelles complex 1 subunit 6
UniProt Protein Name
Biogenesis of lysosome-related organelles complex 1 subunit 6
UniProt Gene Name
BLOC1S6
UniProt Synonym Gene Names
PA; PLDN; BLOC-1 subunit 6
UniProt Entry Name
BL1S6_HUMAN

NCBI Description

The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Mutations in this gene cause symptoms associated with Hermansky-Pudlak syndrome-9. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome. [provided by RefSeq, Aug 2015]

Uniprot Description

PLDN: Involved in the development of lysosome-related organelles, such as melanosomes and platelet-dense granules. May play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process. Defects in PLDN are the cause of Hermansky-Pudlak syndrome type 9 (HPS9). A form of Hermansky-Pudlak syndrome, a genetically heterogeneous autosomal recessive disorder characterized by oculocutaneous albinism, bleeding due to platelet storage pool deficiency, and lysosomal storage defects. This syndrome results from defects of diverse cytoplasmic organelles including melanosomes, platelet dense granules and lysosomes. Ceroid storage in the lungs is associated with pulmonary fibrosis, a common cause of premature death in individuals with HPS. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 15q21.1

Cellular Component: nucleoplasm; SNARE complex; transport vesicle; extrinsic to membrane; cytoplasm; cytosol; endosome

Molecular Function: actin filament binding; identical protein binding; protein binding; protein homodimerization activity; syntaxin binding

Biological Process: positive regulation of pigment cell differentiation; secretion of lysosomal enzymes; melanosome organization and biogenesis; anterograde synaptic vesicle transport; melanocyte differentiation; post-Golgi vesicle-mediated transport; anterograde axon cargo transport; blood coagulation; melanosome transport; positive regulation of natural killer cell activation; neurite development; synaptic vesicle docking during exocytosis

Disease: Hermansky-pudlak Syndrome 9

Research Articles on BLOC1S6

Similar Products

Product Notes

The BLOC1S6 bloc1s6 (Catalog #AAA3211924) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLDN antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PLDN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BLOC1S6 bloc1s6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSVPGPSSPD GALTRPPYCL EAGEPTPGLS DTSPDEGLIE DLTIEDKAVE. It is sometimes possible for the material contained within the vial of "PLDN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.