Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '26400'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
2.56 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '26400' and pd.language_id = 1
Query
Database
1.72 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26400'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
3.18 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '26400'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '26400' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26400'
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value['concentration']
⇄⧉storage_stability => string (486) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.<br><br>FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (17) "Western Blot (WB)"
$value['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value['app_notes']
⇄⧉testing_protocols => string (826) "WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot a...
$value['testing_protocols']
WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in Raw 264.7.||AAA26400_WB6.jpg!!WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in PC-12.||AAA26400_WB5.jpg!!WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in NIH/3T3.||AAA26400_WB4.jpg!!Application Data||Detection limit for recombinant GST tagged RNF2 is approximately 3ng/ml as a capture antibody.||AAA26400_APP3.jpg!!WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in A-549 (Cat # L025V1).||AAA26400_WB2.jpg!!WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in HepG2 (Cat # L019V1).||AAA26400_WB.jpg
Immunogen||RNF2 (NP_009143, 164aa-223aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||IENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDG!!Conjugate||FITC
⇄⧉products_description => string (701) "Polycomb group (PcG) of proteins form the multiprotein complexes that are im...
$value['products_description']
Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq]
⇄products_references => string (3) "N/A"
$value['products_references']
⇄⧉products_related_diseases => string (191) "Neoplasms||9!!Lymphoma||4!!Immune System Diseases||4!!Carcinoma||2!!Lymphati...
$value['products_related_diseases']
Neoplasms||9!!Lymphoma||4!!Immune System Diseases||4!!Carcinoma||2!!Lymphatic Diseases||2!!Breast Neoplasms||2!!Anemia||1!!Kidney Diseases||1!!Abnormalities, Drug-Induced||1!!Drug Toxicity||1
⇄⧉ncbi_protein_info => string (182) "E3 ubiquitin-protein ligase RING2; HIP2-interacting protein 3; RING finger p...
$value['ncbi_protein_info']
E3 ubiquitin-protein ligase RING2; HIP2-interacting protein 3; RING finger protein 1B; RING finger protein BAP-1; huntingtin-interacting protein 2-interacting protein 3; protein DinG
⇄⧉sp_protein_name_syn => string (178) "Huntingtin-interacting protein 2-interacting protein 3; HIP2-interacting pro...
$value['sp_protein_name_syn']
Huntingtin-interacting protein 2-interacting protein 3; HIP2-interacting protein 3; Protein DinG; RING finger protein 1B; RING1b; RING finger protein 2; RING finger protein BAP-1
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value->a['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄⧉storage_stability => string (486) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value->a['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.<br><br>FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (17) "Western Blot (WB)"
$value->a['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value->a['app_notes']
⇄⧉testing_protocols => string (826) "WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot a...
$value->a['testing_protocols']
WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in Raw 264.7.||AAA26400_WB6.jpg!!WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in PC-12.||AAA26400_WB5.jpg!!WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in NIH/3T3.||AAA26400_WB4.jpg!!Application Data||Detection limit for recombinant GST tagged RNF2 is approximately 3ng/ml as a capture antibody.||AAA26400_APP3.jpg!!WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in A-549 (Cat # L025V1).||AAA26400_WB2.jpg!!WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in HepG2 (Cat # L019V1).||AAA26400_WB.jpg
Immunogen||RNF2 (NP_009143, 164aa-223aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||IENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDG!!Conjugate||FITC
⇄⧉products_description => string (701) "Polycomb group (PcG) of proteins form the multiprotein complexes that are im...
$value->a['products_description']
Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq]
⇄products_references => string (3) "N/A"
$value->a['products_references']
⇄⧉products_related_diseases => string (191) "Neoplasms||9!!Lymphoma||4!!Immune System Diseases||4!!Carcinoma||2!!Lymphati...
$value->a['products_related_diseases']
Neoplasms||9!!Lymphoma||4!!Immune System Diseases||4!!Carcinoma||2!!Lymphatic Diseases||2!!Breast Neoplasms||2!!Anemia||1!!Kidney Diseases||1!!Abnormalities, Drug-Induced||1!!Drug Toxicity||1
⇄⧉ncbi_protein_info => string (182) "E3 ubiquitin-protein ligase RING2; HIP2-interacting protein 3; RING finger p...
$value->a['ncbi_protein_info']
E3 ubiquitin-protein ligase RING2; HIP2-interacting protein 3; RING finger protein 1B; RING finger protein BAP-1; huntingtin-interacting protein 2-interacting protein 3; protein DinG
⇄⧉sp_protein_name_syn => string (178) "Huntingtin-interacting protein 2-interacting protein 3; HIP2-interacting pro...
$value->a['sp_protein_name_syn']
Huntingtin-interacting protein 2-interacting protein 3; HIP2-interacting protein 3; Protein DinG; RING finger protein 1B; RING1b; RING finger protein 2; RING finger protein BAP-1
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value->d['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄⧉storage_stability => string (486) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value->d['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.<br><br>FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (17) "Western Blot (WB)"
$value->d['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value->d['app_notes']
⇄⧉testing_protocols => string (826) "WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot a...
$value->d['testing_protocols']
WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in Raw 264.7.||AAA26400_WB6.jpg!!WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in PC-12.||AAA26400_WB5.jpg!!WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in NIH/3T3.||AAA26400_WB4.jpg!!Application Data||Detection limit for recombinant GST tagged RNF2 is approximately 3ng/ml as a capture antibody.||AAA26400_APP3.jpg!!WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in A-549 (Cat # L025V1).||AAA26400_WB2.jpg!!WB (Western Blot)||RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in HepG2 (Cat # L019V1).||AAA26400_WB.jpg
Immunogen||RNF2 (NP_009143, 164aa-223aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||IENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDG!!Conjugate||FITC
⇄⧉products_description => string (701) "Polycomb group (PcG) of proteins form the multiprotein complexes that are im...
$value->d['products_description']
Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq]
⇄products_references => string (3) "N/A"
$value->d['products_references']
⇄⧉products_related_diseases => string (191) "Neoplasms||9!!Lymphoma||4!!Immune System Diseases||4!!Carcinoma||2!!Lymphati...
$value->d['products_related_diseases']
Neoplasms||9!!Lymphoma||4!!Immune System Diseases||4!!Carcinoma||2!!Lymphatic Diseases||2!!Breast Neoplasms||2!!Anemia||1!!Kidney Diseases||1!!Abnormalities, Drug-Induced||1!!Drug Toxicity||1
⇄⧉ncbi_protein_info => string (182) "E3 ubiquitin-protein ligase RING2; HIP2-interacting protein 3; RING finger p...
$value->d['ncbi_protein_info']
E3 ubiquitin-protein ligase RING2; HIP2-interacting protein 3; RING finger protein 1B; RING finger protein BAP-1; huntingtin-interacting protein 2-interacting protein 3; protein DinG
⇄⧉sp_protein_name_syn => string (178) "Huntingtin-interacting protein 2-interacting protein 3; HIP2-interacting pro...
$value->d['sp_protein_name_syn']
Huntingtin-interacting protein 2-interacting protein 3; HIP2-interacting protein 3; Protein DinG; RING finger protein 1B; RING1b; RING finger protein 2; RING finger protein BAP-1
⇄⧉specificity => string (376) "This assay has high sensitivity and excellent specificity for detection of I...
$value[0]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of IL-5. No significant cross-reactivity or interference between IL-5 and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between IL-5 and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[0]['_source']['purity']
⇄form => string (3) "N/A"
$value[0]['_source']['form']
⇄concentration => string (3) "N/A"
$value[0]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
Assay Type||Quantitative Competitive!!Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Sensitivity||1.0 pg/mL
⇄⧉etc_term2 => string (198) "Intended Uses||This IL-5 ELISA kit is a 1.5 hour solid-phase ELISA designed ...
$value[0]['_source']['etc_term2']
Intended Uses||This IL-5 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of monkey IL-5. This ELISA kit for research use only, not for therapeutic applications!
⇄⧉products_description => string (1390) "Principle of the Assay: IL-5 ELISA kit applies the competitive enzyme immuno...
$value[0]['_source']['products_description']
Principle of the Assay: IL-5 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-IL-5 antibody and an IL-5-HRP conjugate. The assay sample and buffer are incubated together with IL-5-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the IL-5 concentration since IL-5 from samples and IL-5-HRP conjugate compete for the anti-IL-5 antibody binding site. Since the number of sites is limited, as more sites are occupied by IL-5 from the sample, fewer sites are left to bind IL-5-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The IL-5 concentration in each sample is interpolated from this standard curve.<br><br>Intended Uses: This IL-5 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Monkey IL-5. This ELISA kit for research use only, not for therapeutic or diagnostic applications!
⇄⧉search_terms => string (601) "aaa16941 monkey typical testing data standard curve for reference only aaa16...
$value[0]['_source']['search_terms']
aaa16941 monkey typical testing data standard curve for reference only aaa16941_td elisa kit interleukin 5 il il5 trf bcgf ii b cell growth factor t replacing cytotoxic lymphocyte inducer eosinophil differentiation colony stimulating 15,207 da il5_rat 54019426 np_068606.1 q08125 nm_021834.1 immunology samples serum plasma culture supernatants body fluid and tissue homogenate assay type sandwich detection range 50 1000pg ml sensitivity 1.0pg intended uses this is a 1.5 hour solid phase designed the quantitative determination of research use not therapeutic applications! interleukin5 range50 a1.5
⇄⧉products_description => string (828) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[1]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Porcine IL-5 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (425) "aaa12808 porcine typical testing data standard curve for reference only aaa1...
$value[1]['_source']['search_terms']
aaa12808 porcine typical testing data standard curve for reference only aaa12808_sc elisa kit interleukin 5 il il5 edf trf t cell replacing factor b differentiation i eosinophil colony stimulating 15,238 da il5_human 4504671 np_000870.1 p05113 nm_000879.2 q13840 147850 samples serum plasma or culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to intra precision interleukin5
⇄⧉specificity => string (182) "This assay has high sensitivity and excellent specificity for detection of h...
$value[2]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human IL-5. No significant cross-reactivity or interference between human IL-5 and analogues was observed.
⇄purity => string (3) "N/A"
$value[2]['_source']['purity']
⇄form => string (3) "N/A"
$value[2]['_source']['form']
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[2]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[2]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[2]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for IL-5 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any IL-5 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for IL-5 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of IL-5 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (531) "aaa15705 human this assay has high sensitivity and excellent specificity for...
$value[2]['_source']['search_terms']
aaa15705 human this assay has high sensitivity and excellent specificity for detection of il 5 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15705_td elisa kit interleukin colony stimulating factor eosinophil edf trf b cell differentiation i t replacing il5 15,238 da il5_human 4504671 np_000870.1 p05113 nm_000879.2 q13840 147850 samples serum plasma tissue homogenates type sandwich range 0.78 pg ml 50 0.195 intra precision within an cv ml50
⇄⧉products_description => string (826) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[3]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human IL-4 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (490) "aaa13040 human typical testing data standard curve for reference only aaa130...
$value[3]['_source']['search_terms']
aaa13040 human typical testing data standard curve for reference only aaa13040_sc elisa kit interleukin 4 il isoform 1 il4 bsf1 bcgf1 bsf bcgf binetrakin pitrakinra b cell growth factor variant 2 b_cell stimulatory lymphocyte 15,797 da il4_human 4504669 np_000580.1 p05112 nm_000589.3 q14630 q6nz77 gene 601367 samples serum plasma or culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision interleukin4 isoform1 variant2 to5
⇄⧉products_description => string (680) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[4]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is Guinea pig IL-4 monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄⧉search_terms => string (532) "aaa12904 guinea pig no cross reaction with other factors typical testing dat...
$value[4]['_source']['search_terms']
aaa12904 guinea pig no cross reaction with other factors typical testing data standard curve for reference only aaa12904_sc elisa kit interleukin 4 il isoform 1 il4 bsf1 bcgf1 bsf bcgf binetrakin pitrakinra b cell growth factor variant 2 b_cell stimulatory lymphocyte 15,797 da il4_human 4504669 np_000580.1 p05112 nm_000589.3 q14630 q6nz77 gene 601367 samples serum plasma or culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision interleukin4 isoform1 variant2 to5
⇄⧉specificity => string (167) "This assay has high sensitivity and excellent specificity for detection of I...
$value[5]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of IL6. No significant cross-reactivity or interference between IL6 and analogues was observed.
⇄purity => string (3) "N/A"
$value[5]['_source']['purity']
⇄form => string (3) "N/A"
$value[5]['_source']['form']
⇄concentration => string (3) "N/A"
$value[5]['_source']['concentration']
⇄⧉storage_stability => string (202) "For unopened kit, all reagents should be kept according to the labels on via...
$value[5]['_source']['storage_stability']
For unopened kit, all reagents should be kept according to the labels on vials. The TMB Substrate, Wash Buffer, Stop Solution should be stored at 4 degree C. All others should be stored at -20 degree C.
Samples||Serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids!!Assay Type||Quantitative Sandwich!!Detection Range||31.2-2000pg/mL!!Sensitivity||< 14.6pg/mL
⇄⧉etc_term2 => string (412) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[5]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level IL6 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level IL6 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄⧉products_description => string (1045) "Intended Uses: The kit is a sandwich enzyme immunoassay for the in vitro qua...
$value[5]['_source']['products_description']
Intended Uses: The kit is a sandwich enzyme immunoassay for the in vitro quantitative measurement of IL6 in mouse serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.<br><br>Principle of the Assay: The microtiter plate provided in this kit has been pre-coated with an antibody specific to IL6. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific to IL6. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain IL6, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +/- 10nm. The concentration of IL6 in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (858) "aaa13900 mouse this assay has high sensitivity and excellent specificity for...
$value[5]['_source']['search_terms']
aaa13900 mouse this assay has high sensitivity and excellent specificity for detection of il6 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa13900_sc elisa kit interleukin 6 mgi2 a mgi2a hgf bsf2 hsf ifnb2 b cell stimulatory factor 2 hybridoma plasmacytoma growth hepatocyte stimulating cytotoxic t differentiation isoform il 24,384 da hp 1 930945756 np_001300983.1 p08505 nm_001314054.1 q3ucq0 q8bn26 samples serum plasma tissue homogenates lysates culture supernates other biological fluids type quantitative sandwich range 31.2 2000pg ml < 14.6pg intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv<10 inter assays different plates 8 replicates in each cv = sd meanx100 cv<12 interleukin6 factor2 hp1 an3 tested20 plates8
⇄⧉specificity => string (167) "This assay has high sensitivity and excellent specificity for detection of I...
$value[6]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of IL5. No significant cross-reactivity or interference between IL5 and analogues was observed.
⇄purity => string (3) "N/A"
$value[6]['_source']['purity']
⇄form => string (3) "N/A"
$value[6]['_source']['form']
⇄concentration => string (3) "N/A"
$value[6]['_source']['concentration']
⇄⧉storage_stability => string (202) "For unopened kit, all reagents should be kept according to the labels on via...
$value[6]['_source']['storage_stability']
For unopened kit, all reagents should be kept according to the labels on vials. The TMB Substrate, Wash Buffer, Stop Solution should be stored at 4 degree C. All others should be stored at -20 degree C.
Samples||Serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids!!Assay Type||Quantitative Sandwich!!Detection Range||15.6-1000pg/mL!!Sensitivity||< 5.4pg/mL
⇄⧉etc_term2 => string (412) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[6]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level IL5 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level IL5 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄⧉products_description => string (1046) "Intended Uses: The kit is a sandwich enzyme immunoassay for the in vitro qua...
$value[6]['_source']['products_description']
Intended Uses: The kit is a sandwich enzyme immunoassay for the in vitro quantitative measurement of IL5 in canine serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.<br><br>Principle of the Assay: The microtiter plate provided in this kit has been pre-coated with an antibody specific to IL5. Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody preparation specific to IL5. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain IL5, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +/- 10nm. The concentration of IL5 in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (732) "aaa14043 canine this assay has high sensitivity and excellent specificity fo...
$value[6]['_source']['search_terms']
aaa14043 canine this assay has high sensitivity and excellent specificity for detection of il5 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa14043_sc elisa kit interleukin 5 15,307 da eosinophil differentiation factor t cell replacing trf il 55741698 np_001006951.1 q95j76 nm_001006950.1 samples serum plasma tissue homogenates lysates culture supernates other biological fluids type quantitative sandwich range 15.6 1000pg ml < 5.4pg intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv<10 inter assays different plates 8 replicates in each cv = sd meanx100 cv<12 interleukin5 an3 tested20 plates8
⇄⧉specificity => string (167) "This assay has high sensitivity and excellent specificity for detection of I...
$value[7]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of IL6. No significant cross-reactivity or interference between IL6 and analogues was observed.
⇄purity => string (3) "N/A"
$value[7]['_source']['purity']
⇄form => string (3) "N/A"
$value[7]['_source']['form']
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄⧉storage_stability => string (475) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[7]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. <br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
Assay Type||Double-antibody Sandwich!!Samples||Serum, Plasma, Tissue homogenates, Cell lysates, Cell culture supernates and other biological fluids!!Detection Range||15.6-1,000pg/mL!!Sensitivity||5.5pg/mL
⇄⧉etc_term2 => string (412) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[7]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level IL6 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level IL6 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄⧉products_description => string (1019) "Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantit...
$value[7]['_source']['products_description']
Intended Uses: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of IL6 in equine serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.<br><br>Principle of the Assay: The microplate provided in this kit has been pre-coated with an antibody specific to IL6. Standards or samples are then added to the appropriate microplate wells with a biotin-conjugated antibody specific to IL6. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain IL6, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm +/- 10nm. The concentration of IL6 in the samples is then determined by comparing the O.D. of the samples to the standard curve.
⇄⧉search_terms => string (868) "aaa20333 horse this assay has high sensitivity and excellent specificity for...
$value[7]['_source']['search_terms']
aaa20333 horse this assay has high sensitivity and excellent specificity for detection of il6 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa20333_sc elisa kit interleukin 6 mgi2 a mgi2a hgf bsf2 hsf ifnb2 b cell stimulatory factor 2 hybridoma plasmacytoma growth hepatocyte stimulating cytotoxic t differentiation il 23,718 da bsf ctl cdf interferon beta ifn il6_human 10834984 np_000591.1 p05231 nm_000600.3 q9ucu2 q9ucu3 q9ucu4 147620 cytokine tumor immunity infection cardiovascular biology samples serum plasma tissue homogenates lysates culture supernates other biological fluids type quantitative sandwich range 7.8 500pg ml < 2.7pg intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv interleukin6 factor2 range7.8 an3 tested20
⇄⧉specificity => string (181) "This assay has high sensitivity and excellent specificity for detection of s...
$value[8]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of sheep IL-4. No significant cross-reactivity or interference between sheep IL-4 and analogues was observed.
⇄purity => string (3) "N/A"
$value[8]['_source']['purity']
⇄form => string (3) "N/A"
$value[8]['_source']['form']
⇄concentration => string (3) "N/A"
$value[8]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[8]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[8]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[8]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for IL-4 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any IL-4 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for IL-4 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of IL-4 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (644) "aaa15769 sheep this assay has high sensitivity and excellent specificity for...
$value[8]['_source']['search_terms']
aaa15769 sheep this assay has high sensitivity and excellent specificity for detection of il 4 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15769_td elisa kit interleukin bcgf 1 bcgf1 bsf1 mgc79402 b cell growth factor b_cell stimulatory lymphocyte il4 bsf 15,136 da il4_sheep 57527820 np_001009313.2 p30368 nm_001009313.2 q95mz6 samples serum plasma tissue homogenates type quantitative sandwich range 6.25 pg ml 400 < 1.56 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in ml400
⇄⧉specificity => string (177) "This assay has high sensitivity and excellent specificity for detection of d...
$value[9]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of dog IL-4. No significant cross-reactivity or interference between dog IL-4 and analogues was observed.
⇄purity => string (3) "N/A"
$value[9]['_source']['purity']
⇄form => string (3) "N/A"
$value[9]['_source']['form']
⇄concentration => string (3) "N/A"
$value[9]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[9]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
Samples||Serum, plasma, tissue homogenates.!!Assay Type||Sandwich!!Detection Range||6.25 pg/ml-400 pg/ml.!!Sensitivity||Typically less than 1.56 pg/ml
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[9]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[9]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for IL-4 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any IL-4 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for IL-4 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of IL-4 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (647) "aaa15295 dog this assay has high sensitivity and excellent specificity for d...
$value[9]['_source']['search_terms']
aaa15295 dog this assay has high sensitivity and excellent specificity for detection of il 4 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15295_td elisa kit interleukin bcgf 1 bcgf1 bsf1 mgc79402 b cell growth factor b_cell stimulatory lymphocyte il4 bsf 15,267 da il4_canfa 50978886 np_001003159.1 o77762 nm_001003159.1 a1e293 samples serum plasma tissue homogenates type sandwich range 6.25 pg ml 400 typically less than 1.56 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in ml400
⇄⧉products_description => string (1368) "Intended Uses: This IL-17A ELISA kit is a 1.5 hour solid-phase ELISA designe...
$value[10]['_source']['products_description']
Intended Uses: This IL-17A ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Rabbit IL-17A. This ELISA kit for research use only!<br><br>Principle of the Assay: IL-17A ELISA kit applies the competitive enzyme immunoassay technique utilizing a monoclonal anti-IL-17A antibody and an IL-17A-HRP conjugate. The assay sample and buffer are incubated together with IL-17A-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the IL-17A concentration since IL-17A from samples and IL-17A-HRP conjugate compete for the anti-IL-17A antibody binding site. Since the number of sites is limited, as more sites are occupied by IL-17A from the sample, fewer sites are left to bind IL-17A-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The IL-17A concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (454) "aaa16259 rabbit typical testing data standard curve for reference only aaa16...
$value[10]['_source']['search_terms']
aaa16259 rabbit typical testing data standard curve for reference only aaa16259_td elisa kit interleukin 17a il il17a il17 ctla8 17 ctla 8 cytotoxic t lymphocyte associated antigen protein serine esterase 17,504 da il17_human 4504651 np_002181.1 q16552 nm_002190.2 q5t2p0 603149 immunology samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type sandwich detection range 100 2500pg ml sensitivity 1.0pg ctla817 range100
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of I...
$value[11]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of IL-4. No significant cross-reactivity or interference between IL-4 and analogues was observed.
⇄purity => string (3) "N/A"
$value[11]['_source']['purity']
⇄form => string (3) "N/A"
$value[11]['_source']['form']
⇄concentration => string (3) "N/A"
$value[11]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[11]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉etc_term1 => string (152) "Assay Type||Sandwich!!Samples||Serum, plasma, tissue homogenates and other b...
$value[11]['_source']['etc_term1']
Assay Type||Sandwich!!Samples||Serum, plasma, tissue homogenates and other biological fluids!!Detection Range||15.625-1000pg/ml!!Sensitivity||9.375pg/ml
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[11]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄⧉search_terms => string (578) "aaa27584 hamster this assay has high sensitivity and excellent specificity f...
$value[11]['_source']['search_terms']
aaa27584 hamster this assay has high sensitivity and excellent specificity for detection of il 4 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa27584_sc elisa kit interleukin isoform 1 il4 bsf1 bcgf1 bsf bcgf 15,797 da b cell stimulatory factor binetrakin lymphocyte pitrakinra 4504669 np_000580.1 p05112 nm_000589.3 q14630 q6nz77 m13982 mrna samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 15.625 1000pg ml 9.375pg intra precision cv isoform1
⇄⧉products_description => string (828) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[12]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Chicken IL-6 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (476) "aaa13072 chicken typical testing data standard curve for reference only aaa1...
$value[12]['_source']['search_terms']
aaa13072 chicken typical testing data standard curve for reference only aaa13072_sc elisa kit interleukin 6 il il6 hgf hsf bsf2 ifnb2 cdf bsf 2 ifn beta interferon hybridoma growth factor ctl differentiation b cell stimulatory 23,718 da il6_human 10834984 np_000591.1 p05231 nm_000600.3 q9ucu2 q9ucu3 q9ucu4 604302 samples serum plasma or culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision interleukin6 to5
⇄⧉products_description => string (831) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[13]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Guinea pig IL-6 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉products_description => string (826) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[14]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Mouse IL-6 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (474) "aaa12586 mouse typical testing data standard curve for reference only aaa125...
$value[14]['_source']['search_terms']
aaa12586 mouse typical testing data standard curve for reference only aaa12586_sc elisa kit interleukin 6 il il6 hgf hsf bsf2 ifnb2 cdf bsf 2 ifn beta interferon hybridoma growth factor ctl differentiation b cell stimulatory 23,718 da il6_human 10834984 np_000591.1 p05231 nm_000600.3 q9ucu2 q9ucu3 q9ucu4 604302 samples serum plasma or culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision interleukin6 to5
⇄⧉products_description => string (824) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[15]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat IL-6 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (472) "aaa13162 rat typical testing data standard curve for reference only aaa13162...
$value[15]['_source']['search_terms']
aaa13162 rat typical testing data standard curve for reference only aaa13162_sc elisa kit interleukin 6 il il6 hgf hsf bsf2 ifnb2 cdf bsf 2 ifn beta interferon hybridoma growth factor ctl differentiation b cell stimulatory 23,718 da il6_human 10834984 np_000591.1 p05231 nm_000600.3 q9ucu2 q9ucu3 q9ucu4 604302 samples serum plasma or culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision interleukin6 to5
⇄⧉specificity => string (177) "This assay has high sensitivity and excellent specificity for detection of r...
$value[16]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of rat IL-4. No significant cross-reactivity or interference between rat IL-4 and analogues was observed.
⇄purity => string (3) "N/A"
$value[16]['_source']['purity']
⇄form => string (3) "N/A"
$value[16]['_source']['form']
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[16]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[16]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (731) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[16]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for IL-4 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any IL-4 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for IL-4 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of IL-4 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (807) "aaa15013 rat this assay has high sensitivity and excellent specificity for d...
$value[16]['_source']['search_terms']
aaa15013 rat this assay has high sensitivity and excellent specificity for detection of il4 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15013_td elisa kit interleukin 4 il bcgf 1 bcgf1 bsf1 mgc79402 b cell growth factor b_cell stimulatory lymphocyte isoform il2 bsf 16,562 da il4_rabit 253683508 np_001156649.1 q9mzr8 nm_001163177.1 q0ms70 samples serum plasma tissue homogenates culture supernates range 1.56 pg ml 100 0.39 intra precision within an cv is less than 8 three known concentration were tested twenty times on one plate to assess inter assays 10 in wavelength 450 nm sample volume 50 100ul protein biological process immunity 3 activation interleukin4 ml100 than8 assays10 wavelength450 volume50 immunity3
⇄⧉products_description => string (825) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[17]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Goat IL-6 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (510) "aaa12730 goat no cross reaction with other factors typical testing data stan...
$value[17]['_source']['search_terms']
aaa12730 goat no cross reaction with other factors typical testing data standard curve for reference only aaa12730_sc elisa kit interleukin 6 il il6 hgf hsf bsf2 ifnb2 cdf bsf 2 ifn beta interferon hybridoma growth factor ctl differentiation b cell stimulatory 23,718 da il6_human 10834984 np_000591.1 p05231 nm_000600.3 q9ucu2 q9ucu3 q9ucu4 604302 samples serum plasma or culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision interleukin6 to5
⇄⧉products_description => string (828) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[18]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Porcine IL-6 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (513) "aaa12854 porcine no cross reaction with other factors typical testing data s...
$value[18]['_source']['search_terms']
aaa12854 porcine no cross reaction with other factors typical testing data standard curve for reference only aaa12854_sc elisa kit interleukin 6 il il6 hgf hsf bsf2 ifnb2 cdf bsf 2 ifn beta interferon hybridoma growth factor ctl differentiation b cell stimulatory 23,718 da il6_human 10834984 np_000591.1 p05231 nm_000600.3 q9ucu2 q9ucu3 q9ucu4 604302 samples serum plasma or culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision interleukin6 to5
⇄⧉products_description => string (1392) "Intended Uses: This IL-12RB2 ELISA kit is a 1.5 hour solid-phase ELISA desig...
$value[19]['_source']['products_description']
Intended Uses: This IL-12RB2 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of HumanIL-12RB2. This ELISA kit for research use only!<br><br>Principle of the Assay: IL-12RB2 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-IL-12RB2 antibody and an IL-12RB2-HRP conjugate. The assay sample and buffer are incubated together with IL-12RB2-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the IL-12RB2 concentration since IL-12RB2 from samples and IL-12RB2-HRP conjugate compete for the anti-IL-12RB2 antibody binding site. Since the number of sites is limited, as more sites are occupied by IL-12RB2 from the sample, fewer sites are left to bind IL-12RB2-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The IL-12RB2 concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (454) "aaa16371 guinea pig typical testing data standard curve for reference only a...
$value[19]['_source']['search_terms']
aaa16371 guinea pig typical testing data standard curve for reference only aaa16371_sc elisa kit interleukin 17a il il17a il17 ctla8 17 ctla 8 cytotoxic t lymphocyte associated antigen protein serine esterase 17,504 da il17_human 4504651 np_002181.1 q16552 nm_002190.2 q5t2p0 603149 immunology samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type quantitative competitive sensitivity 0.1 ng ml ctla817 sensitivity0.1
