Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human PLCXD2 Polyclonal Antibody | anti-PLCXD2 antibody

PLCXD2 Polyclonal Antibody

Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
PLCXD2; Polyclonal Antibody; PLCXD2 Polyclonal Antibody; anti-PLCXD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MLAVRKARRKLRMGTICSPNPSGTKTSSEVCNADWMASLPPHLHNLPLSNLAIPGSHDSFSYWVDEKSPVGPDQTQAIKRLARISLVKKLMKKWSVTQNLTFREQLEAGIRYFDLRVSSKPGDADQEIYFIHGLFGIKVWDGLMEIDSFLTQHPQEIIFLDFNHFYAMDETHHKCLVLRIQEAFGNKLCPACSVESLTLRTLWEKNCQVLIFYHCPFYKQYPFLWPGKKIPAPWANTTSVRKLILFLETTLSERA
Sequence Length
305
Applicable Applications for anti-PLCXD2 antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:100
Immunogen
Recombinant protein of human PLCXD2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-PLCXD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
PI-PLC X domain-containing protein 2 isoform a
NCBI Official Synonym Full Names
phosphatidylinositol specific phospholipase C X domain containing 2
NCBI Official Symbol
PLCXD2
NCBI Protein Information
PI-PLC X domain-containing protein 2
UniProt Protein Name
PI-PLC X domain-containing protein 2
UniProt Gene Name
PLCXD2

Research Articles on PLCXD2

Similar Products

Product Notes

The PLCXD2 plcxd2 (Catalog #AAA9134174) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLCXD2 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLCXD2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:100. Researchers should empirically determine the suitability of the PLCXD2 plcxd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLAVRKARRK LRMGTICSPN PSGTKTSSEV CNADWMASLP PHLHNLPLSN LAIPGSHDSF SYWVDEKSPV GPDQTQAIKR LARISLVKKL MKKWSVTQNL TFREQLEAGI RYFDLRVSSK PGDADQEIYF IHGLFGIKVW DGLMEIDSFL TQHPQEIIFL DFNHFYAMDE THHKCLVLRI QEAFGNKLCP ACSVESLTLR TLWEKNCQVL IFYHCPFYKQ YPFLWPGKKI PAPWANTTSV RKLILFLETT LSERA. It is sometimes possible for the material contained within the vial of "PLCXD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.