Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PLA2G7Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PLA2G7 Polyclonal Antibody | anti-PLA2G7 antibody

PLA2G7 Antibody - middle region

Gene Names
PLA2G7; PAFAD; PAFAH; LP-PLA2; LDL-PLA2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PLA2G7; Polyclonal Antibody; PLA2G7 Antibody - middle region; anti-PLA2G7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSH
Sequence Length
441
Applicable Applications for anti-PLA2G7 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PLA2G7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PLA2G7Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PLA2G7Sample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PLA2G7 antibody
The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-PLA2G7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50 kDa
NCBI Official Full Name
platelet-activating factor acetylhydrolase
NCBI Official Synonym Full Names
phospholipase A2 group VII
NCBI Official Symbol
PLA2G7
NCBI Official Synonym Symbols
PAFAD; PAFAH; LP-PLA2; LDL-PLA2
NCBI Protein Information
platelet-activating factor acetylhydrolase
UniProt Protein Name
Platelet-activating factor acetylhydrolase
UniProt Gene Name
PLA2G7
UniProt Synonym Gene Names
PAFAH; PAF acetylhydrolase; gVIIA-PLA2; LDL-PLA(2)
UniProt Entry Name
PAFA_HUMAN

NCBI Description

The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2009]

Uniprot Description

PLA2G7: Modulates the action of platelet-activating factor (PAF) by hydrolyzing the sn-2 ester bond to yield the biologically inactive lyso-PAF. Has a specificity for substrates with a short residue at the sn-2 position. It is inactive against long-chain phospholipids. Defects in PLA2G7 are the cause of platelet-activating factor acetylhydrolase deficiency (PAFAD). An enzymatic deficiency that results in exacerbated bodily response to inflammatory agents. Asthmatic individuals affected by this condition may manifest severe respiratory symptoms. Defects in PLA2G7 are a cause of susceptibility to asthma (ASTHMA). The most common chronic disease affecting children and young adults. It is a complex genetic disorder with a heterogeneous phenotype, largely attributed to the interactions among many genes and between these genes and the environment. It is characterized by recurrent attacks of paroxysmal dyspnea, with weezing due to spasmodic contraction of the bronchi. PLA2G7 variants can be a risk factor for the development of asthma and PLA2G7 may act as a modifier gene that modulates the severity of this disease. Defects in PLA2G7 are a cause of susceptibility to atopic hypersensitivity (ATOPY). A condition characterized by predisposition to develop hypersensitivity reactions. Atopic individuals can develop eczema, allergic rhinitis and allergic asthma. Belongs to the AB hydrolase superfamily. Lipase family.

Protein type: Hydrolase; EC 3.1.1.47; Lipid Metabolism - ether lipid; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 6p21.2-p12

Cellular Component: cytoplasm; extracellular region

Molecular Function: calcium-independent phospholipase A2 activity; phospholipid binding; 1-alkyl-2-acetylglycerophosphocholine esterase activity

Biological Process: cellular protein metabolic process; lipid catabolic process; positive regulation of inflammatory response

Disease: Asthma, Susceptibility To; Ige Responsiveness, Atopic; Platelet-activating Factor Acetylhydrolase Deficiency

Research Articles on PLA2G7

Similar Products

Product Notes

The PLA2G7 pla2g7 (Catalog #AAA3221675) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLA2G7 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLA2G7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLA2G7 pla2g7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EYFWGLSKFL GTHWLMGNIL RLLFGSMTTP ANWNSPLRPG EKYPLVVFSH. It is sometimes possible for the material contained within the vial of "PLA2G7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.