Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-PLA2G5 antibodyFormalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 10 ug/ml)

Rabbit PLA2G5 Polyclonal Antibody | anti-PLA2G5 antibody

PLA2G5 antibody - N-terminal region

Gene Names
PLA2G5; FRFB; GV-PLA2; PLA2-10; hVPLA(2)
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PLA2G5; Polyclonal Antibody; PLA2G5 antibody - N-terminal region; anti-PLA2G5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW
Sequence Length
138
Applicable Applications for anti-PLA2G5 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 85%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 85%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PLA2G5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PLA2G5 antibodyFormalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 10 ug/ml)

Immunohistochemistry (IHC) (Rabbit Anti-PLA2G5 antibodyFormalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 10 ug/ml)

Western Blot (WB)

(WB Suggested Anti-PLA2G5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)

Western Blot (WB) (WB Suggested Anti-PLA2G5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Thymus)
Related Product Information for anti-PLA2G5 antibody
This is a rabbit polyclonal antibody against PLA2G5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholip
Product Categories/Family for anti-PLA2G5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
calcium-dependent phospholipase A2
NCBI Official Synonym Full Names
phospholipase A2 group V
NCBI Official Symbol
PLA2G5
NCBI Official Synonym Symbols
FRFB; GV-PLA2; PLA2-10; hVPLA(2)
NCBI Protein Information
calcium-dependent phospholipase A2
UniProt Protein Name
Calcium-dependent phospholipase A2
UniProt Gene Name
PLA2G5
UniProt Entry Name
PA2G5_HUMAN

NCBI Description

This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1. The encoded enzyme catalyzes the hydrolysis of membrane phospholipids to generate lysophospholipids and free fatty acids including arachidonic acid. It preferentially hydrolyzes linoleoyl-containing phosphatidylcholine substrates. Secretion of this enzyme is thought to induce inflammatory responses in neighboring cells. Alternatively spliced transcript variants have been found, but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

PLA2G5: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L- alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L- alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle. Defects in PLA2G5 are the cause of fleck retina, familial benign (FRFB). An autosomal recessive condition associated with a distinctive retinal appearance and no apparent visual or electrophysiologic deficits. Affected individuals are asymptomatic, but fundus examination reveals a striking pattern of diffuse, yellow-white, fleck-like lesions extending to the far periphery of the retina but sparing the foveal region. Belongs to the phospholipase A2 family.

Protein type: Lipid Metabolism - arachidonic acid; Lipid Metabolism - glycerophospholipid; EC 3.1.1.4; Secreted, signal peptide; Secreted; Cell surface; Lipid Metabolism - linoleic acid; Lipid Metabolism - alpha-linolenic acid; Phospholipase; Lipid Metabolism - ether lipid

Chromosomal Location of Human Ortholog: 1p36-p34

Cellular Component: Golgi apparatus; cell surface; perinuclear region of cytoplasm; extracellular region; plasma membrane

Molecular Function: heparin binding; calcium-dependent phospholipase A2 activity; calcium ion binding

Biological Process: leukotriene biosynthetic process; platelet activating factor biosynthetic process; response to cAMP; response to cytokine stimulus; phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidic acid biosynthetic process; arachidonic acid secretion; lipid catabolic process

Disease: Fleck Retina, Familial Benign

Research Articles on PLA2G5

Similar Products

Product Notes

The PLA2G5 pla2g5 (Catalog #AAA3205838) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLA2G5 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PLA2G5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLA2G5 pla2g5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKGLLPLAWF LACSVPAVQG GLLDLKSMIE KVTGKNALTN YGFYGCYCGW. It is sometimes possible for the material contained within the vial of "PLA2G5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.