Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PLA2G10 expression in transfected 293T cell line by PLA2G10 polyclonal antibody. Lane 1: PLA2G10 transfected lysate (18.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PLA2G10 Polyclonal Antibody | anti-PLA2G10 antibody

PLA2G10 (Group 10 Secretory Phospholipase A2, Group X Secretory Phospholipase A2, GX sPLA2, sPLA2-X, Phosphatidylcholine 2-acylhydrolase 10, MGC119918, MGC119919, MGC133367) APC

Gene Names
PLA2G10; SPLA2; GXPLA2; GXSPLA2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PLA2G10; Polyclonal Antibody; PLA2G10 (Group 10 Secretory Phospholipase A2; Group X Secretory Phospholipase A2; GX sPLA2; sPLA2-X; Phosphatidylcholine 2-acylhydrolase 10; MGC119918; MGC119919; MGC133367) APC; anti-PLA2G10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PLA2G10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PLA2G10 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PLA2G10, aa1-165 (NP_003552.1).
Immunogen Sequence
MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PLA2G10 expression in transfected 293T cell line by PLA2G10 polyclonal antibody. Lane 1: PLA2G10 transfected lysate (18.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PLA2G10 expression in transfected 293T cell line by PLA2G10 polyclonal antibody. Lane 1: PLA2G10 transfected lysate (18.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PLA2G10 antibody
PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. Has a powerful potency for releasing arachidonic acid from cell membrane phospholipids. Prefers phosphatidylethanolamine and phosphatidylcholine liposomes to those of phosphatidylserine.
Product Categories/Family for anti-PLA2G10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,153 Da
NCBI Official Full Name
group 10 secretory phospholipase A2
NCBI Official Synonym Full Names
phospholipase A2, group X
NCBI Official Symbol
PLA2G10
NCBI Official Synonym Symbols
SPLA2; GXPLA2; GXSPLA2
NCBI Protein Information
group 10 secretory phospholipase A2; GX sPLA2; group X secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 10; sPLA2-X
UniProt Protein Name
Group 10 secretory phospholipase A2
UniProt Gene Name
PLA2G10
UniProt Synonym Gene Names
GX sPLA2; sPLA2-X
UniProt Entry Name
PA2GX_HUMAN

Uniprot Description

PLA2G10: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Has a powerful potency for releasing arachidonic acid from cell membrane phospholipids. Prefers phosphatidylethanolamine and phosphatidylcholine liposomes to those of phosphatidylserine. Belongs to the phospholipase A2 family.

Protein type: Secreted; Lipid Metabolism - arachidonic acid; Secreted, signal peptide; Cell development/differentiation; Lipid Metabolism - ether lipid; Lipid Metabolism - alpha-linolenic acid; Lipid Metabolism - linoleic acid; Phospholipase; Lipid Metabolism - glycerophospholipid; EC 3.1.1.4; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 16p13.1-p12

Cellular Component: extracellular region

Molecular Function: phospholipase A2 activity; calcium ion binding; phospholipase activity

Biological Process: axon guidance; cholesterol homeostasis; phospholipid metabolic process; negative regulation of transcription factor activity; regulation of macrophage activation; lysophospholipid transport; positive regulation of cellular protein metabolic process; glycerophospholipid biosynthetic process; positive regulation of prostaglandin secretion; phosphatidic acid biosynthetic process; arachidonic acid metabolic process; lipid catabolic process

Research Articles on PLA2G10

Similar Products

Product Notes

The PLA2G10 pla2g10 (Catalog #AAA6389637) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLA2G10 (Group 10 Secretory Phospholipase A2, Group X Secretory Phospholipase A2, GX sPLA2, sPLA2-X, Phosphatidylcholine 2-acylhydrolase 10, MGC119918, MGC119919, MGC133367) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLA2G10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PLA2G10 pla2g10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLA2G10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.