Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PITRM1Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PITRM1 Polyclonal Antibody | anti-PITRM1 antibody

PITRM1 Antibody - middle region

Gene Names
PITRM1; MP1; PreP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PITRM1; Polyclonal Antibody; PITRM1 Antibody - middle region; anti-PITRM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELDFWQEGWRLEHENPSDPQTPLVFKGVVFNEMKGAFTDNERIFSQHLQN
Sequence Length
1037
Applicable Applications for anti-PITRM1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PITRM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PITRM1Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PITRM1Sample Tissue: Human Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PITRM1 antibody
ATP-independent protease that degrades mitochondrial transit peptides after their cleavage. Also degrades other unstructured peptides. Specific for peptides in the range of 10 to 65 residues. Able to degrade amyloid beta A4 (APP) protein when it accumulates in mitochondrion, suggesting a link with Alzheimer disease. Shows a preference for cleavage after small polar residues and before basic residues, but without any positional preference.
Product Categories/Family for anti-PITRM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
114 kDa
NCBI Official Full Name
presequence protease, mitochondrial isoform 1
NCBI Official Synonym Full Names
pitrilysin metallopeptidase 1
NCBI Official Symbol
PITRM1
NCBI Official Synonym Symbols
MP1; PreP
NCBI Protein Information
presequence protease, mitochondrial
UniProt Protein Name
Presequence protease, mitochondrial
UniProt Gene Name
PITRM1
UniProt Synonym Gene Names
KIAA1104; MP1; hPreP; Metalloprotease 1; hMP1
UniProt Entry Name
PREP_HUMAN

NCBI Description

The protein encoded by this gene is an ATP-dependent metalloprotease that degrades post-cleavage mitochondrial transit peptides. The encoded protein binds zinc and can also degrade amyloid beta A4 protein, suggesting a possible role in Alzheimer's disease. [provided by RefSeq, Dec 2016]

Research Articles on PITRM1

Similar Products

Product Notes

The PITRM1 pitrm1 (Catalog #AAA3222184) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PITRM1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PITRM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PITRM1 pitrm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELDFWQEGWR LEHENPSDPQ TPLVFKGVVF NEMKGAFTDN ERIFSQHLQN. It is sometimes possible for the material contained within the vial of "PITRM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.