Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PIN4 expression in transfected 293T cell line by PIN4 polyclonal antibody. Lane 1: PIN4 transfected lysate (16.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PIN4 Polyclonal Antibody | anti-PIN4 antibody

PIN4 (Peptidyl-prolyl Cis-trans Isomerase NIMA-interacting 4, Peptidyl-prolyl Cis-trans Isomerase Pin4, PPIase Pin4, Rotamase Pin4, Parvulin-14, Par14, Parvulin-17, Par17, Peptidyl-prolyl Cis/trans Isomerase EPVH, hEPVH) APC

Gene Names
PIN4; EPVH; PAR14; PAR17
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PIN4; Polyclonal Antibody; PIN4 (Peptidyl-prolyl Cis-trans Isomerase NIMA-interacting 4; Peptidyl-prolyl Cis-trans Isomerase Pin4; PPIase Pin4; Rotamase Pin4; Parvulin-14; Par14; Parvulin-17; Par17; Peptidyl-prolyl Cis/trans Isomerase EPVH; hEPVH) APC; anti-PIN4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PIN4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PIN4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PIN4, aa1-156 (NP_006214.2).
Immunogen Sequence
MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PIN4 expression in transfected 293T cell line by PIN4 polyclonal antibody. Lane 1: PIN4 transfected lysate (16.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PIN4 expression in transfected 293T cell line by PIN4 polyclonal antibody. Lane 1: PIN4 transfected lysate (16.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PIN4 antibody
PIN4, also known as Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4, is peptidyl-prolyl cis/trans isomerase (PPIase) that interacts with NIMA and is essential for cell cycle regulation. There are two different isoforms which are PAR14 and PAR17. PIN4/PAR17 was imported into mitochondria in a time and membrane potential-dependent manner, where it reached the mitochondrial matrix. Moreover, Pin4 protein was shown to bind to double-stranded DNA under physiological salt conditions.
Product Categories/Family for anti-PIN4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,810 Da
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 isoform 1
NCBI Official Synonym Full Names
protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)
NCBI Official Symbol
PIN4
NCBI Official Synonym Symbols
EPVH; PAR14; PAR17
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase NIMA-interacting 4; hEPVH; hPar14; hPar17; PPIase PIN4; parvulin-14; parvulin-17; rotamase PIN4; eukaryotic parvulin homolog; peptidyl-prolyl cis-trans isomerase Pin4; peptidyl-prolyl cis/trans isomerase EPVH
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4
UniProt Gene Name
PIN4
UniProt Synonym Gene Names
Par14; hPar14; Par17; hPar17; PPIase Pin4; hEPVH
UniProt Entry Name
PIN4_HUMAN

NCBI Description

This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ribosome biogenesis. The encoded protein may play an additional role in the mitochondria. [provided by RefSeq, Dec 2009]

Uniprot Description

PIN4: Isoform 1 is involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to tightly bent AT-rich stretches of double-stranded DNA. Belongs to the PpiC/parvulin rotamase family. PIN4 subfamily. 2 isoforms of the human protein are produced by alternative promoter.

Protein type: Nucleolus; EC 5.2.1.8; Mitochondrial; Isomerase

Chromosomal Location of Human Ortholog: Xq13

Cellular Component: mitochondrial matrix; cytoplasm; nucleolus; spindle; nucleus

Molecular Function: peptidyl-prolyl cis-trans isomerase activity; DNA binding; double-stranded DNA binding; bent DNA binding

Biological Process: protein peptidyl-prolyl isomerization; rRNA processing

Research Articles on PIN4

Similar Products

Product Notes

The PIN4 pin4 (Catalog #AAA6389450) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIN4 (Peptidyl-prolyl Cis-trans Isomerase NIMA-interacting 4, Peptidyl-prolyl Cis-trans Isomerase Pin4, PPIase Pin4, Rotamase Pin4, Parvulin-14, Par14, Parvulin-17, Par17, Peptidyl-prolyl Cis/trans Isomerase EPVH, hEPVH) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIN4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PIN4 pin4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIN4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.