Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: PIM1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Rabbit PIM1 Polyclonal Antibody | anti-PIM1 antibody

PIM1 antibody - N-terminal region

Gene Names
PIM1; PIM
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIM1; Polyclonal Antibody; PIM1 antibody - N-terminal region; anti-PIM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
Sequence Length
313
Applicable Applications for anti-PIM1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PIM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: PIM1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: PIM1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: MouseTarget Name: PIM1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: PIM1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PIM1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PIM1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PIM1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PIM1Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: PIM1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PIM1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-PIM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-PIM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)
Related Product Information for anti-PIM1 antibody
This is a rabbit polyclonal antibody against PIM1. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is expressed primarily in B-lymphoid and myeloid cell lines, and is overexpressed in hematopoietic malignancies and in prostate cancer. It plays a role in signal transduction in blood cells, contributing to both cell proliferation and survival, and thus provides a selective advantage in tumorigenesis. Both the human and orthologous mouse genes have been reported to encode two isoforms (with preferential cellular localization) resulting from the use of alternative in-frame translation initiation codons, the upstream non-AUG (CUG) and downstream AUG codons.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
serine/threonine-protein kinase pim-1 isoform 2
NCBI Official Synonym Full Names
Pim-1 proto-oncogene, serine/threonine kinase
NCBI Official Symbol
PIM1
NCBI Official Synonym Symbols
PIM
NCBI Protein Information
serine/threonine-protein kinase pim-1
UniProt Protein Name
Serine/threonine-protein kinase pim-1
Protein Family
UniProt Gene Name
PIM1
UniProt Entry Name
PIM1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is expressed primarily in B-lymphoid and myeloid cell lines, and is overexpressed in hematopoietic malignancies and in prostate cancer. It plays a role in signal transduction in blood cells, contributing to both cell proliferation and survival, and thus provides a selective advantage in tumorigenesis. Both the human and orthologous mouse genes have been reported to encode two isoforms (with preferential cellular localization) resulting from the use of alternative in-frame translation initiation codons, the upstream non-AUG (CUG) and downstream AUG codons (PMIDs:16186805, 1825810).[provided by RefSeq, Aug 2011]

Uniprot Description

Pim1: a proto-oncogene serine/threonine kinase involved in cell survival and cell proliferation and thus providing a selective advantage in tumorigenesis. Exerts its oncogenic activity through: the regulation of MYC transcriptional activity, the regulation of cell cycle progression and by phosphorylation and inhibition of proapoptotic proteins (BAD, MAP3K5, FOXO3). Phosphorylation of MYC leads to an increase of MYC protein stability and thereby an increase of transcriptional activity. The stabilization of MYC exerced by PIM1 might explain partly the strong synergism between these two oncogenes in tumorigenesis. Mediates survival signaling through phosphorylation of BAD, which induces release of the anti-apoptotic protein Bcl- X(L)/BCL2L1. Phosphorylation of ASK1 an other proapoptotic protein, by PIM1, significantly decreases ASK1 kinase activity and inhibits MAP3K5-mediated phosphorylation of JNK and JNK/p38MAPK subsequently reducing caspase-3 activation and cell apoptosis. Stimulates cell cycle progression at the G1-S and G2-M transitions by phosphorylation of CDC25A and CDC25C. Phosphorylation of p21Cip1, a regulator of cell cycle progression at G1, results in the relocation of p21Cip1 to the cytoplasm and enhanced p21Cip1 protein stability. Promote cell cycle progression and tumorigenesis by down-regulating expression of a regulator of cell cycle progression, p27Kip1, at both transcriptional and post- translational levels. Phosphorylation of p27Kip1,induces 14-3-3- proteins binding, nuclear export and proteasome-dependent degradation. May affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Acts also as a regulator of homing and migration of bone marrow cells involving functional interaction with the CXCL12-CXCR4 signaling axis. Isoform 2 is isolated as a monomer whereas isoform 1 complexes with other proteins. Binds to RP9. Isoform 1, but not isoform 2, binds BMX. Isoform 2 interacts with p27Kip1 and FOXO3. Interacts with BAD. Interacts with PPP2CA; this interaction promotes dephosphorylation of PIM1, ubiquitination and proteasomal degradation. Interacts with HSP90, this interaction stabilizes PIM1 protein levels. Ubiquitinated form interacts with HSP70 and promotes its proteosomal degradation. Strongly induced in leukocytes by the JAK/STAT pathway in response to cytokines. Induced by different cellular stresses, heat shock and cytotoxic agents. Expressed primarily in cells of the hematopoietic and germline lineages. 2 isoforms of the human protein are produced by alternative initiation. Both isoforms are expressed in prostate cancer cell lines.

Protein type: Protein kinase, CAMK; Oncoprotein; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; CAMK group; PIM family

Chromosomal Location of Human Ortholog: 6p21.2

Cellular Component: cytoplasm; plasma membrane; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; manganese ion binding; transcription factor binding; ribosomal small subunit binding; ATP binding

Biological Process: cell proliferation; apoptosis; negative regulation of transcription factor activity; multicellular organismal development; protein amino acid autophosphorylation; regulation of mitotic cell cycle; cell cycle; G1/S-specific positive regulation of cyclin-dependent protein kinase activity; hyaluronan metabolic process; protein amino acid phosphorylation; negative regulation of apoptosis

Research Articles on PIM1

Similar Products

Product Notes

The PIM1 pim1 (Catalog #AAA3212742) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIM1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's PIM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIM1 pim1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLLSKINSLA HLRAAPCNDL HATKLAPGKE KEPLESQYQV GPLLGSGGFG. It is sometimes possible for the material contained within the vial of "PIM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.