Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PIK3R3 Antibody Titration: 5.0ug/mlPositive Control: Transfected 293T)

Rabbit PIK3R3 Polyclonal Antibody | anti-PIK3R3 antibody

PIK3R3 antibody - middle region

Gene Names
PIK3R3; p55; p55PIK; p55-GAMMA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
PIK3R3; Polyclonal Antibody; PIK3R3 antibody - middle region; anti-PIK3R3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE
Sequence Length
461
Applicable Applications for anti-PIK3R3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PIK3R3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PIK3R3 Antibody Titration: 5.0ug/mlPositive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-PIK3R3 Antibody Titration: 5.0ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-PIK3R3 antibody
This is a rabbit polyclonal antibody against PIK3R3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PIK3R3 binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1.
Product Categories/Family for anti-PIK3R3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
phosphatidylinositol 3-kinase regulatory subunit gamma isoform 1
NCBI Official Synonym Full Names
phosphoinositide-3-kinase regulatory subunit 3
NCBI Official Symbol
PIK3R3
NCBI Official Synonym Symbols
p55; p55PIK; p55-GAMMA
NCBI Protein Information
phosphatidylinositol 3-kinase regulatory subunit gamma
UniProt Protein Name
Phosphatidylinositol 3-kinase regulatory subunit gamma
UniProt Gene Name
PIK3R3
UniProt Synonym Gene Names
PI3-kinase regulatory subunit gamma; PI3K regulatory subunit gamma; PtdIns-3-kinase regulatory subunit gamma; PI3-kinase subunit p55-gamma; PtdIns-3-kinase regulatory subunit p55-gamma
UniProt Entry Name
P55G_HUMAN

NCBI Description

Phosphatidylinositol 3-kinase (PI3K) phosphorylates phosphatidylinositol and similar compounds, which then serve as second messengers in growth signaling pathways. PI3K is composed of a catalytic and a regulatory subunit. The protein encoded by this gene represents a regulatory subunit of PI3K. The encoded protein contains two SH2 domains through which it binds activated protein tyrosine kinases to regulate their activity. [provided by RefSeq, Jun 2016]

Uniprot Description

PIK3R3: Binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1. Heterodimer of a regulatory subunit PIK3R3 and a p110 catalytic subunit (PIK3CA, PIK3CB or PIK3CD). Interacts with AXL. Highest levels in brain and testis. Lower levels in adipose tissue, kidney, heart, lung and skeletal muscle. Belongs to the PI3K p85 subunit family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Kinase, lipid

Chromosomal Location of Human Ortholog: 1p34.1

Cellular Component: cytosol; phosphoinositide 3-kinase complex

Molecular Function: protein binding; 1-phosphatidylinositol-3-kinase activity; phosphoinositide 3-kinase regulator activity

Biological Process: phospholipid metabolic process; phosphatidylinositol biosynthetic process; insulin receptor signaling pathway; regulation of phosphoinositide 3-kinase activity

Research Articles on PIK3R3

Similar Products

Product Notes

The PIK3R3 pik3r3 (Catalog #AAA3201584) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIK3R3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3R3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIK3R3 pik3r3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EYTRTSQEIQ MKRTAIEAFN ETIKIFEEQC HTQEQHSKEY IERFRREGNE. It is sometimes possible for the material contained within the vial of "PIK3R3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.