Western Blot (WB)
(WB Suggested Anti-PIGO Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateThere is BioGPS gene expression data showing that PIGO is expressed in HeLa)
Rabbit PIGO Polyclonal Antibody | anti-PIGO antibody
PIGO antibody - N-terminal region
Gene Names
PIGO; HPMRS2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIGO; Polyclonal Antibody; PIGO antibody - N-terminal region; anti-PIGO antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS
Sequence Length
672
Applicable Applications for anti-PIGO antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PIGO
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PIGO Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateThere is BioGPS gene expression data showing that PIGO is expressed in HeLa)
Western Blot (WB)
(WB Suggested Anti-PIGO Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateThere is BioGPS gene expression data showing that PIGO is expressed in HeLa)
Related Product Information for anti-PIGO antibody
This is a rabbit polyclonal antibody against PIGO. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: PIGO is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. PIGO is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI.This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This protein is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI. At least two alternatively spliced transcripts encoding distinct isoforms have been found for this gene.
Target Description: PIGO is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. PIGO is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI.This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This protein is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI. At least two alternatively spliced transcripts encoding distinct isoforms have been found for this gene.
Product Categories/Family for anti-PIGO antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
74kDa
NCBI Official Full Name
GPI ethanolamine phosphate transferase 3 isoform 2
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis class O
NCBI Official Symbol
PIGO
NCBI Official Synonym Symbols
HPMRS2
NCBI Protein Information
GPI ethanolamine phosphate transferase 3
NCBI Description
This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This protein is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI. At least three alternatively spliced transcripts encoding two distinct isoforms have been found for this gene. [provided by RefSeq, Jan 2011]
Research Articles on PIGO
Similar Products
Product Notes
The PIGO (Catalog #AAA3209785) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIGO antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PIGO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIGO for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LIDALRFDFA QPQHSHVPRE PPVSLPFLGK LSSLQRILEI QPHHARLYRS. It is sometimes possible for the material contained within the vial of "PIGO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
