Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Mouse Pancreas )

Rabbit Pias2 Polyclonal Antibody | anti-PIAS2 antibody

Pias2 antibody - C-terminal region

Gene Names
Pias2; Dib; Miz1; SIZ2; ARIP3; PIASxb; AI462206; AU018068; PIASxbeta; PIASxalpha; 6330408K17Rik
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Pias2; Polyclonal Antibody; Pias2 antibody - C-terminal region; anti-PIAS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSSSRSE
Sequence Length
490
Applicable Applications for anti-PIAS2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Horse: 100%; Human: 93%; Mouse: 100%; Rabbit: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Pias2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Mouse Pancreas )

Immunohistochemistry (IHC) (Mouse Pancreas )

Western Blot (WB)

(WB Suggested Anti-Pias2 Antibody Titration: 0.2-1 ug/mlPositive Control: NIH/3T3 cell lysate)

Western Blot (WB) (WB Suggested Anti-Pias2 Antibody Titration: 0.2-1 ug/mlPositive Control: NIH/3T3 cell lysate)

Western Blot (WB)

(WB Suggested Anti-Pias2 antibody Titration: 1 ug/mLSample Type: Human heart)

Western Blot (WB) (WB Suggested Anti-Pias2 antibody Titration: 1 ug/mLSample Type: Human heart)
Related Product Information for anti-PIAS2 antibody
This is a rabbit polyclonal antibody against Pias2. It was validated on Western Blot and immunohistochemistry

Target Description: Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. It plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. It seems to be mostly involved in gene silencing. It binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
Msx-interacting-zinc finger protein 1
NCBI Official Synonym Full Names
protein inhibitor of activated STAT 2
NCBI Official Symbol
Pias2
NCBI Official Synonym Symbols
Dib; Miz1; SIZ2; ARIP3; PIASxb; AI462206; AU018068; PIASxbeta; PIASxalpha; 6330408K17Rik
NCBI Protein Information
E3 SUMO-protein ligase PIAS2
UniProt Protein Name
E3 SUMO-protein ligase PIAS2
Protein Family
UniProt Gene Name
Pias2
UniProt Synonym Gene Names
Miz1; Piasx; ARIP3; DIP
UniProt Entry Name
PIAS2_MOUSE

Uniprot Description

PIAS2: Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulator in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. The effects of this transcriptional coregulation, transactivation or silencing may vary depending upon the biological context and the PIAS2 isoform studied. However, it seems to be mostly involved in gene silencing. Binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity. Isoform PIAS2-beta, but not isoform PIAS2-alpha, promotes MDM2 sumoylation. Isoform PIAS2-alpha promotes PARK7 sumoylation. Isoform PIAS2-beta promotes NCOA2 sumoylation more efficiently than isoform PIAS2- alpha. Belongs to the PIAS family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: SUMO conjugating system; Nuclear receptor co-regulator; EC 6.3.2.-; Transcription, coactivator/corepressor

Cellular Component: nuclear body; PML body; nucleus

Molecular Function: protein domain specific binding; zinc ion binding; coenzyme F420-2 alpha-glutamyl ligase activity; metal ion binding; ribosomal S6-glutamic acid ligase activity; SUMO ligase activity; transcription factor binding; protein binding; DNA binding; androgen receptor binding; UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine ligase activity; ubiquitin protein ligase binding; estrogen receptor binding; coenzyme F420-0 gamma-glutamyl ligase activity; ligase activity; glucocorticoid receptor binding

Biological Process: regulation of transcription from RNA polymerase II promoter; protein sumoylation; regulation of osteoblast differentiation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; negative regulation of transcription factor activity; androgen receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; positive regulation of dendrite morphogenesis

Research Articles on PIAS2

Similar Products

Product Notes

The PIAS2 pias2 (Catalog #AAA3203372) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Pias2 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's Pias2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PIAS2 pias2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSLIPVDPQY CPPMFLDSLT SPLTASSTSV TTTSPHESST HVSSSSSRSE. It is sometimes possible for the material contained within the vial of "Pias2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.