PGP9.5 Polyclonal Antibody | anti-PGP9.5 antibody

Anti-PGP9.5 Antibody

Cat. Num. AAA178319

• Gene Names: UCHL1; NDGOA; PARK5; PGP95; PGP9.5; Uch-L1; HEL-117; PGP 9.5; HEL-S-53
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: PGP9.5; Polyclonal Antibody; Anti-PGP9.5 Antibody; Ubiquitin carboxyl-terminal hydrolase isozyme L1; Neuron cytoplasmic protein 9.5; OTTHUMP00000218137; OTTHUMP00000218139; OTTHUMP00000218140; OTTHUMP00000218141; Park 5; PARK5; PGP 9.5; PGP95; Protein gene product 9.5; Ubiquitin C terminal esterase L1; Ubiquitin C terminal hydrolase; Ubiquitin carboxyl terminal esterase L1; Ubiquitin carboxyl terminal hydrolase isozyme L1; Ubiquitin thioesterase L1; Ubiquitin thiolesterase; Ubiquitin thiolesterase L1; UCH-L1; UCHL1; UCHL1_HUMAN; ubiquitin C-terminal hydrolase L1; anti-PGP9.5 antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 223

• Applicable Applications for anti-PGP9.5 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PGP9.5 (120-153aa ETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCR), different from the related mouse and rat sequences by two amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- PGP9.5 Picoband antibody, MBS178319, Western blottingAll lanes: Anti PGP9.5 (MBS178319) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: U87 Whole Cell Lysate at 40ugPredicted bind size: 25KDObserved bind size: 25KD)

Immunohistochemistry (IHC)

(Anti- PGP9.5 Picoband antibody, MBS178319, IHC(P)IHC(P): Mouse Brain Tissue )

Immunohistochemistry (IHC)

(Anti- PGP9.5 Picoband antibody, MBS178319, IHC(P)IHC(P): Rat Brain Tissue )

Immunohistochemistry (IHC)

(Anti- PGP9.5 Picoband antibody, MBS178319, IHC(P)IHC(P): Human Glioma Tissue )

Related Product Information for anti-PGP9.5 antibody

Description: Rabbit IgG polyclonal antibody for Ubiquitin carboxyl-terminal hydrolase isozyme L1(UCHL1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: UCH-L1, also known as PGP9.5, is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer. Expression of UCH-L1 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary. The catalytic triad of UCH-L1 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.

References

1. "Entrez Gene: UCHL1 ubiquitin carboxyl-terminal esterase L1 (ubiquitin thiolesterase)". 2. Das C, Hoang QQ, Kreinbring CA, Luchansky SJ, Meray RK, Ray SS, Lansbury PT, Ringe D, Petsko GA (Mar 2006). "Structural basis for conformational plasticity of the Parkinson's disease-associated ubiquitin hydrolase UCH-L1". Proceedings of the National Academy of Sciences of the United States of America 103 (12): 4675-80. 3. Doran JF, Jackson P, Kynoch PA, Thompson RJ (Jun 1983). "Isolation of PGP 9.5, a new human neurone-specific protein detected by high-resolution two-dimensional electrophoresis". Journal of Neurochemistry 40 (6): 1542-7.

NCBI and Uniprot Product Information

• NCBI GI #: 21361091
• NCBI GeneID: 7345
• NCBI Accession #: NP_004172.2
• NCBI GenBank Nucleotide #: NM_004181.4
• UniProt Accession #: P09936; Q4W5K6; Q71UM0
• Molecular Weight: 24,824 Da
• NCBI Official Full Name: ubiquitin carboxyl-terminal hydrolase isozyme L1
• NCBI Official Synonym Full Names: ubiquitin C-terminal hydrolase L1
• NCBI Official Symbol: UCHL1
• NCBI Official Synonym Symbols: NDGOA; PARK5; PGP95; PGP9.5; Uch-L1; HEL-117; PGP 9.5; HEL-S-53
• NCBI Protein Information: ubiquitin carboxyl-terminal hydrolase isozyme L1
• UniProt Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L1
• UniProt Gene Name: UCHL1
• UniProt Synonym Gene Names: UCH-L1; PGP9.5
• UniProt Entry Name: UCHL1_HUMAN

NCBI Description

The protein encoded by this gene belongs to the peptidase C12 family. This enzyme is a thiol protease that hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. This gene is specifically expressed in the neurons and in cells of the diffuse neuroendocrine system. Mutations in this gene may be associated with Parkinson disease.[provided by RefSeq, Sep 2009]

Uniprot Description

UCHL1: Ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. Also binds to free monoubiquitin and may prevent its degradation in lysosomes. The homodimer may have ATP-independent ubiquitin ligase activity. Monomer. Homodimer. Interacts with SNCA. Interacts with COPS5. Found in neuronal cell bodies and processes throughout the neocortex. Expressed in neurons and cells of the diffuse neuroendocrine system and their tumors. Weakly expressed in ovary. Down-regulated in brains from Parkinson disease and Alzheimer disease patients. Belongs to the peptidase C12 family.

Protein type: Cell development/differentiation; Ligase; EC 3.4.19.12; Protease; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 4p14

Cellular Component: cell soma; cytoplasm; cytosol; endoplasmic reticulum membrane; myelin sheath; nucleoplasm; plasma membrane

Molecular Function: alpha-2A adrenergic receptor binding; cysteine-type endopeptidase activity; ligase activity; omega peptidase activity; protein binding; ubiquitin binding; ubiquitin protein ligase binding; ubiquitin-specific protease activity

Biological Process: adult walking behavior; axon target recognition; axon transport of mitochondrion; cell proliferation; eating behavior; muscle fiber development; negative regulation of MAP kinase activity; neuromuscular process; proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination; regulation of macroautophagy; sensory perception of pain

Disease: Neurodegeneration With Optic Atrophy, Childhood-onset; Parkinson Disease 5, Autosomal Dominant