Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PGDS expression in transfected 293T cell line by PGDS polyclonal antibody. Lane 1: PGDS transfected lysate (23.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PGDS Polyclonal Antibody | anti-PGDS antibody

PGDS (HPGDS, Hematopoietic Prostaglandin D Synthase, H-PGDS, GST Class-sigma, Glutathione S-transferase, Glutathione-dependent PGD Synthase, Glutathione-requiring Prostaglandin D Synthase, Prostaglandin-H2 D-isomerase, GSTS, PTGDS2) (AP)

Gene Names
HPGDS; GSTS; PGD2; PGDS; GSTS1; GSTS1-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PGDS; Polyclonal Antibody; PGDS (HPGDS; Hematopoietic Prostaglandin D Synthase; H-PGDS; GST Class-sigma; Glutathione S-transferase; Glutathione-dependent PGD Synthase; Glutathione-requiring Prostaglandin D Synthase; Prostaglandin-H2 D-isomerase; GSTS; PTGDS2) (AP); anti-PGDS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PGDS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
1615
Applicable Applications for anti-PGDS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PGDS, aa1-199 (NP_055300.1).
Immunogen Sequence
MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PGDS expression in transfected 293T cell line by PGDS polyclonal antibody. Lane 1: PGDS transfected lysate (23.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PGDS expression in transfected 293T cell line by PGDS polyclonal antibody. Lane 1: PGDS transfected lysate (23.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PGDS antibody
HPGDS, also known as GSTS, is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.
Product Categories/Family for anti-PGDS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens hematopoietic prostaglandin D synthase (HPGDS), mRNA
NCBI Official Synonym Full Names
hematopoietic prostaglandin D synthase
NCBI Official Symbol
HPGDS
NCBI Official Synonym Symbols
GSTS; PGD2; PGDS; GSTS1; GSTS1-1
NCBI Protein Information
hematopoietic prostaglandin D synthase
UniProt Protein Name
Hematopoietic prostaglandin D synthase
UniProt Gene Name
HPGDS
UniProt Synonym Gene Names
GSTS; PGDS; PTGDS2; H-PGDS
UniProt Entry Name
HPGDS_HUMAN

NCBI Description

Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. [provided by RefSeq, Jul 2008]

Uniprot Description

Ptgds2: Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of aryl halides and organic isothiocyanates. Also exhibits low glutathione-peroxidase activity towards cumene hydroperoxide. Belongs to the GST superfamily. Sigma family.

Protein type: EC 2.5.1.18; Lipid Metabolism - arachidonic acid; EC 5.3.99.2; Isomerase

Chromosomal Location of Human Ortholog: 4q22.3

Cellular Component: cytoplasm; cytosol

Molecular Function: prostaglandin-D synthase activity; protein homodimerization activity; glutathione transferase activity; magnesium ion binding; calcium ion binding

Biological Process: xenobiotic metabolic process; cyclooxygenase pathway; arachidonic acid metabolic process; locomotory behavior; signal transduction; prostaglandin metabolic process

Research Articles on PGDS

Similar Products

Product Notes

The PGDS hpgds (Catalog #AAA6389185) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PGDS (HPGDS, Hematopoietic Prostaglandin D Synthase, H-PGDS, GST Class-sigma, Glutathione S-transferase, Glutathione-dependent PGD Synthase, Glutathione-requiring Prostaglandin D Synthase, Prostaglandin-H2 D-isomerase, GSTS, PTGDS2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PGDS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PGDS hpgds for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PGDS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.