Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PGDS antibody (MBS5301707) used at 1 ug/ml to detect target protein.)

Rabbit PGDS Polyclonal Antibody | anti-PGDS antibody

PGDS antibody

Gene Names
HPGDS; GSTS; PGD2; PGDS; GSTS1; GSTS1-1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
PGDS; Polyclonal Antibody; PGDS antibody; Polyclonal PGDS; Anti-PGDS; Prostaglandin D2 Synthase Hematopoietic; anti-PGDS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
PGDS antibody was raised against the N terminal of PGDS
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGDS antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
199
Applicable Applications for anti-PGDS antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
PGDS is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(PGDS antibody (MBS5301707) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (PGDS antibody (MBS5301707) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-PGDS antibody
Rabbit polyclonal PGDS antibody raised against the N terminal of PGDS
Product Categories/Family for anti-PGDS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
23 kDa (MW of target protein)
NCBI Official Full Name
PGDS, partial
NCBI Official Synonym Full Names
hematopoietic prostaglandin D synthase
NCBI Official Symbol
HPGDS
NCBI Official Synonym Symbols
GSTS; PGD2; PGDS; GSTS1; GSTS1-1
NCBI Protein Information
hematopoietic prostaglandin D synthase
UniProt Protein Name
Hematopoietic prostaglandin D synthase
UniProt Gene Name
HPGDS
UniProt Synonym Gene Names
GSTS; PGDS; PTGDS2; H-PGDS
UniProt Entry Name
HPGDS_HUMAN

NCBI Description

Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. [provided by RefSeq, Jul 2008]

Uniprot Description

Ptgds2: Bifunctional enzyme which catalyzes both the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation, and the conjugation of glutathione with a wide range of aryl halides and organic isothiocyanates. Also exhibits low glutathione-peroxidase activity towards cumene hydroperoxide. Belongs to the GST superfamily. Sigma family.

Protein type: EC 5.3.99.2; Isomerase; EC 2.5.1.18; Lipid Metabolism - arachidonic acid

Chromosomal Location of Human Ortholog: 4q22.3

Cellular Component: cytoplasm; cytosol

Molecular Function: protein homodimerization activity; prostaglandin-D synthase activity; glutathione transferase activity; magnesium ion binding; calcium ion binding

Biological Process: xenobiotic metabolic process; cyclooxygenase pathway; arachidonic acid metabolic process; locomotory behavior; signal transduction; prostaglandin metabolic process

Research Articles on PGDS

Similar Products

Product Notes

The PGDS hpgds (Catalog #AAA5301707) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PGDS antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PGDS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the PGDS hpgds for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PGDS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.