Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PGBD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

Rabbit PGBD1 Polyclonal Antibody | anti-PGBD1 antibody

PGBD1 antibody - N-terminal region

Gene Names
PGBD1; SCAND4; HUCEP-4; dJ874C20.4
Reactivity
Cow, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PGBD1; Polyclonal Antibody; PGBD1 antibody - N-terminal region; anti-PGBD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRLRFRHFC
Sequence Length
809
Applicable Applications for anti-PGBD1 antibody
Western Blot (WB)
Homology
Cow: 92%; Human: 100%; Rabbit: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PGBD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PGBD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-PGBD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Related Product Information for anti-PGBD1 antibody
This is a rabbit polyclonal antibody against PGBD1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PGBD1 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known.
Product Categories/Family for anti-PGBD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92kDa
NCBI Official Full Name
piggyBac transposable element-derived protein 1
NCBI Official Synonym Full Names
piggyBac transposable element derived 1
NCBI Official Symbol
PGBD1
NCBI Official Synonym Symbols
SCAND4; HUCEP-4; dJ874C20.4
NCBI Protein Information
piggyBac transposable element-derived protein 1
UniProt Protein Name
PiggyBac transposable element-derived protein 1
UniProt Gene Name
PGBD1
UniProt Entry Name
PGBD1_HUMAN

NCBI Description

The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. This gene product is specifically expressed in the brain, however, its exact function is not known. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, May 2010]

Uniprot Description

PGBD1:

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 6p22.1

Cellular Component: membrane; nucleus

Molecular Function: transcription factor activity; scavenger receptor activity

Biological Process: receptor-mediated endocytosis; regulation of transcription, DNA-dependent

Research Articles on PGBD1

Similar Products

Product Notes

The PGBD1 pgbd1 (Catalog #AAA3202929) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PGBD1 antibody - N-terminal region reacts with Cow, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's PGBD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PGBD1 pgbd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YEALPGPAPE NEDGLVKVKE EDPTWEQVCN SQEGSSHTQE ICRLRFRHFC. It is sometimes possible for the material contained within the vial of "PGBD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.