Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PEX26 Antibody Titration: 0.2-1 ug/mlPositive Control: COLO205 cell lysatePEX26 is supported by BioGPS gene expression data to be expressed in COLO205)

Rabbit PEX26 Polyclonal Antibody | anti-PEX26 antibody

PEX26 antibody - middle region

Gene Names
PEX26; PBD7A; PBD7B; PEX26M1T; Pex26pM1T
Reactivity
Cow, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PEX26; Polyclonal Antibody; PEX26 antibody - middle region; anti-PEX26 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELVVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHK
Sequence Length
305
Applicable Applications for anti-PEX26 antibody
Western Blot (WB)
Homology
Cow: 79%; Horse: 86%; Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PEX26
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PEX26 Antibody Titration: 0.2-1 ug/mlPositive Control: COLO205 cell lysatePEX26 is supported by BioGPS gene expression data to be expressed in COLO205)

Western Blot (WB) (WB Suggested Anti-PEX26 Antibody Titration: 0.2-1 ug/mlPositive Control: COLO205 cell lysatePEX26 is supported by BioGPS gene expression data to be expressed in COLO205)
Related Product Information for anti-PEX26 antibody
This is a rabbit polyclonal antibody against PEX26. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene belongs to the peroxin-26 gene family. It is probably required for protein import into peroxisomes. It anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into pero
Product Categories/Family for anti-PEX26 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
peroxisome assembly protein 26 isoform a
NCBI Official Synonym Full Names
peroxisomal biogenesis factor 26
NCBI Official Symbol
PEX26
NCBI Official Synonym Symbols
PBD7A; PBD7B; PEX26M1T; Pex26pM1T
NCBI Protein Information
peroxisome assembly protein 26
UniProt Protein Name
Peroxisome assembly protein 26
UniProt Gene Name
PEX26
UniProt Entry Name
PEX26_HUMAN

NCBI Description

This gene belongs to the peroxin-26 gene family. It is probably required for protein import into peroxisomes. It anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into peroxisomes. Defects in this gene are the cause of peroxisome biogenesis disorder complementation group 8 (PBD-CG8). PBD refers to a group of peroxisomal disorders arising from a failure of protein import into the peroxisomal membrane or matrix. The PBD group is comprised of four disorders: Zellweger syndrome (ZWS), neonatal adrenoleukodystrophy (NALD), infantile Refsum disease (IRD), and classical rhizomelic chondrodysplasia punctata (RCDP). Alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

PEX26: Probably required for protein import into peroxisomes. Anchors PEX1 and PEX6 to peroxisome membranes, possibly to form heteromeric AAA ATPase complexes required for the import of proteins into peroxisomes. Involved in the import of catalase and proteins containing a PTS2 target sequence, but not in import of proteins with a PTS1 target sequence. Defects in PEX26 are the cause of peroxisome biogenesis disorder complementation group 8 (PBD-CG8); also known as PBD-CGA. PBD refers to a group of peroxisomal disorders arising from a failure of protein import into the peroxisomal membrane or matrix. The PBD group is comprised of four disorders: Zellweger syndrome (ZWS), neonatal adrenoleukodystrophy (NALD), infantile Refsum disease (IRD), and classical rhizomelic chondrodysplasia punctata (RCDP). ZWS, NALD and IRD are distinct from RCDP and constitute a clinical continuum of overlapping phenotypes known as the Zellweger spectrum. The PBD group is genetically heterogeneous with at least 13 distinct genetic groups as concluded from complementation studies. Defects in PEX26 are a cause of Zellweger syndrome (ZWS). ZWS is a fatal peroxisome biogenesis disorder characterized by dysmorphic facial features, hepatomegaly, ocular abnormalities, renal cysts, hearing impairment, profound psychomotor retardation, severe hypotonia and neonatal seizures. Death occurs within the first year of life. Defects in PEX26 are a cause of adrenoleukodystrophy neonatal (NALD). NALD is a peroxisome biogenesis disorder characterized by the accumulation of very long-chain fatty acids, adrenal insufficiency and mental retardation. Defects in PEX26 are a cause of infantile Refsum disease (IRD). IRD is a mild peroxisome biogenesis disorder. Clinical features include early onset, mental retardation, minor facial dysmorphism, retinopathy, sensorineural hearing deficit, hepatomegaly, osteoporosis, failure to thrive, and hypocholesterolemia. The biochemical abnormalities include accumulation of phytanic acid, very long chain fatty acids (VLCFA), di- and trihydroxycholestanoic acid and pipecolic acid. Belongs to the peroxin-26 family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: integral to peroxisomal membrane; peroxisome

Molecular Function: protein C-terminus binding; protein binding; protein complex binding; ATPase binding

Biological Process: protein import into peroxisome matrix; protein import into peroxisome membrane

Disease: Peroxisome Biogenesis Disorder 7b; Peroxisome Biogenesis Disorder 7a (zellweger)

Research Articles on PEX26

Similar Products

Product Notes

The PEX26 pex26 (Catalog #AAA3213158) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PEX26 antibody - middle region reacts with Cow, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's PEX26 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PEX26 pex26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELVVGSAAFG EERRLDVLQA IHTARQQQKQ EHSGSEEAQK PNLEGSVSHK. It is sometimes possible for the material contained within the vial of "PEX26, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.