Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PEX16Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PEX16 Polyclonal Antibody | anti-PEX16 antibody

PEX16 Antibody - middle region

Gene Names
PEX16; PBD8A; PBD8B
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PEX16; Polyclonal Antibody; PEX16 Antibody - middle region; anti-PEX16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQ
Sequence Length
167
Applicable Applications for anti-PEX16 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PEX16
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PEX16Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PEX16Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PEX16 antibody
The protein encoded by this gene is an integral peroxisomal membrane protein. An inactivating nonsense mutation localized to this gene was observed in a patient with Zellweger syndrome of the complementation group CGD/CG9. Expression of this gene product morphologically and biochemically restores the formation of new peroxisomes, suggesting a role in peroxisome organization and biogenesis. Alternative splicing has been observed for this gene and two variants have been described.
Product Categories/Family for anti-PEX16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
peroxisomal biogenesis factor 16 isoform 1
NCBI Official Synonym Full Names
peroxisomal biogenesis factor 16
NCBI Official Symbol
PEX16
NCBI Official Synonym Symbols
PBD8A; PBD8B
NCBI Protein Information
peroxisomal biogenesis factor 16
UniProt Protein Name
Peroxisomal membrane protein PEX16
UniProt Gene Name
PEX16
UniProt Entry Name
PEX16_HUMAN

NCBI Description

The protein encoded by this gene is an integral peroxisomal membrane protein. An inactivating nonsense mutation localized to this gene was observed in a patient with Zellweger syndrome of the complementation group CGD/CG9. Expression of this gene product morphologically and biochemically restores the formation of new peroxisomes, suggesting a role in peroxisome organization and biogenesis. Alternative splicing has been observed for this gene and two variants have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

PEX16: Required for peroxisome membrane biogenesis. May play a role in early stages of peroxisome assembly. Can recruit other peroxisomal proteins, such as PEX3 and PMP34, to de novo peroxisomes derived from the endoplasmic reticulum (ER). May function as receptor for PEX3. Defects in PEX16 are the cause of peroxisome biogenesis disorder complementation group 9 (PBD-CG9); also known as PBD-CGD. PBD refers to a group of peroxisomal disorders arising from a failure of protein import into the peroxisomal membrane or matrix. The PBD group is comprised of four disorders: Zellweger syndrome (ZWS), neonatal adrenoleukodystrophy (NALD), infantile Refsum disease (IRD), and classical rhizomelic chondrodysplasia punctata (RCDP). ZWS, NALD and IRD are distinct from RCDP and constitute a clinical continuum of overlapping phenotypes known as the Zellweger spectrum. The PBD group is genetically heterogeneous with at least 14 distinct genetic groups as concluded from complementation studies. Defects in PEX16 are a cause of Zellweger syndrome (ZWS). ZWS is a fatal peroxisome biogenesis disorder characterized by dysmorphic facial features, hepatomegaly, ocular abnormalities, renal cysts, hearing impairment, profound psychomotor retardation, severe hypotonia and neonatal seizures. Death occurs within the first year of life. Belongs to the peroxin-16 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: peroxisomal membrane; endoplasmic reticulum membrane; integral to peroxisomal membrane; membrane; endoplasmic reticulum; peroxisome

Molecular Function: protein C-terminus binding; protein binding

Biological Process: ER-dependent peroxisome biogenesis; protein targeting to peroxisome; peroxisome organization and biogenesis; protein import into peroxisome matrix; protein to membrane docking; protein import into peroxisome membrane; peroxisome membrane biogenesis

Disease: Peroxisome Biogenesis Disorder 8b; Peroxisome Biogenesis Disorder 8a (zellweger)

Research Articles on PEX16

Similar Products

Product Notes

The PEX16 pex16 (Catalog #AAA3220487) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PEX16 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PEX16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PEX16 pex16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QPPDGDHSPG NHEQSYVGKR SNRVVRTLQN TPSLHSRHWG APQQREGRQQ. It is sometimes possible for the material contained within the vial of "PEX16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.