Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PEX11A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Rabbit PEX11A Polyclonal Antibody | anti-PEX11A antibody

PEX11A antibody - middle region

Gene Names
PEX11A; PMP28; hsPEX11p; PEX11-ALPHA
Reactivity
Cow, Dog, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PEX11A; Polyclonal Antibody; PEX11A antibody - middle region; anti-PEX11A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKRVTCDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLL
Sequence Length
247
Applicable Applications for anti-PEX11A antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Human: 100%; Pig: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PEX11A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PEX11A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-PEX11A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Placenta)
Related Product Information for anti-PEX11A antibody
This is a rabbit polyclonal antibody against PEX11A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PEX11A belongs to the peroxin-11 family. It may be involved in peroxisomal proliferation and may regulate peroxisomes division. PEX11A may mediate binding of coatomer proteins to the peroxisomal membrane.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
peroxisomal membrane protein 11A isoform 1
NCBI Official Synonym Full Names
peroxisomal biogenesis factor 11 alpha
NCBI Official Symbol
PEX11A
NCBI Official Synonym Symbols
PMP28; hsPEX11p; PEX11-ALPHA
NCBI Protein Information
peroxisomal membrane protein 11A
UniProt Protein Name
Peroxisomal membrane protein 11A
UniProt Gene Name
PEX11A
UniProt Synonym Gene Names
PEX11; HsPEX11p; PMP28; PEX11-alpha
UniProt Entry Name
PX11A_HUMAN

NCBI Description

This gene is a member of the PEX11 family, which is composed of membrane elongation factors involved in regulation of peroxisome maintenance and proliferation. This gene product interacts with peroxisomal membrane protein 19 and may respond to outside stimuli to increase peroxisome abundance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2012]

Uniprot Description

PEX11A: May be involved in peroxisomal proliferation and may regulate peroxisomes division. May mediate binding of coatomer proteins to the peroxisomal membrane. Belongs to the peroxin-11 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 15q26.1

Cellular Component: peroxisomal membrane; integral to peroxisomal membrane; protein complex; peroxisome

Molecular Function: protein binding; protein homodimerization activity

Biological Process: peroxisome fission; peroxisome organization and biogenesis; brown fat cell differentiation; cellular lipid metabolic process; signal transduction; peroxisome membrane biogenesis

Research Articles on PEX11A

Similar Products

Product Notes

The PEX11A pex11a (Catalog #AAA3208184) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PEX11A antibody - middle region reacts with Cow, Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's PEX11A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PEX11A pex11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKRVTCDRAK KEKSASQDPL WFSVAEEETE WLQSFLLLLF RSLKQHPPLL. It is sometimes possible for the material contained within the vial of "PEX11A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.