Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PELI1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlPELI1 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit PELI1 Polyclonal Antibody | anti-PELI1 antibody

PELI1 antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PELI1; Polyclonal Antibody; PELI1 antibody - N-terminal region; anti-PELI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA
Sequence Length
418
Applicable Applications for anti-PELI1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PELI1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PELI1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlPELI1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: PELI1Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlPELI1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB)

(WB Suggested Anti-PELI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-PELI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-PELI1 antibody
This is a rabbit polyclonal antibody against PELI1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PELI1 is an scaffold protein involved in the IL-1 signaling pathway via its interaction with the complex containing IRAK kinases and TRAF6. PELI1 is required for NF-kappa-B activation and IL-8 gene expression in response to IL-1.
Product Categories/Family for anti-PELI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase pellino homolog 1
NCBI Official Synonym Full Names
pellino E3 ubiquitin protein ligase 1
NCBI Official Symbol
PELI1
NCBI Protein Information
E3 ubiquitin-protein ligase pellino homolog 1
UniProt Protein Name
E3 ubiquitin-protein ligase pellino homolog 1
UniProt Gene Name
Peli1
UniProt Synonym Gene Names
Pellino-1
UniProt Entry Name
PELI1_MOUSE

Uniprot Description

PELI1: E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1 allowing subsequent NF-kappa-B activation. Found in a complex containing TRAF6, IRAK1 and IRAK4. Interacts with MAP3K7. Belongs to the pellino family.

Protein type: Ligase; EC 6.3.2.-; Ubiquitin ligase; EC 6.3.2.19; Ubiquitin conjugating system; Adaptor/scaffold

Cellular Component: nucleus

Molecular Function: protein binding; coenzyme F420-2 alpha-glutamyl ligase activity; UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine ligase activity; ubiquitin-protein ligase activity; ribosomal S6-glutamic acid ligase activity; coenzyme F420-0 gamma-glutamyl ligase activity; ligase activity

Biological Process: positive regulation of cytokine production; positive regulation of toll-like receptor 3 signaling pathway; protein polyubiquitination; positive regulation of I-kappaB kinase/NF-kappaB cascade; response to dsRNA; positive regulation of toll-like receptor 4 signaling pathway; response to lipopolysaccharide; Toll signaling pathway; negative regulation of T cell proliferation; inhibition of NF-kappaB transcription factor; positive regulation of protein ubiquitination; positive regulation of B cell activation; positive regulation of B cell proliferation; negative regulation of T cell activation

Research Articles on PELI1

Similar Products

Product Notes

The PELI1 peli1 (Catalog #AAA3213359) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PELI1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PELI1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PELI1 peli1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESPIDFVVTD TVPGSQSNSD TQSVQSTISR FACRIICERN PPFTARIYAA. It is sometimes possible for the material contained within the vial of "PELI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.