Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PEG10Sample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PEG10 Polyclonal Antibody | anti-PEG10 antibody

PEG10 Antibody - N-terminal region

Gene Names
PEG10; EDR; HB-1; Mar2; RTL2; MEF3L; Mart2; RGAG3; SIRH1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PEG10; Polyclonal Antibody; PEG10 Antibody - N-terminal region; anti-PEG10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SMMTGRAARWASAKLERSHYLMHNYPAFMMEMKHVFEDPQRREVAKRKIR
Sequence Length
708
Applicable Applications for anti-PEG10 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PEG10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PEG10Sample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PEG10Sample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PEG10 antibody
This is a rabbit polyclonal antibody against PEG10. It was validated on Western Blot

Target Description: This is a paternally expressed imprinted gene that encodes transcripts containing two overlapping open reading frames (ORFs), RF1 and RF1/RF2, as well as retroviral-like slippage and pseudoknot elements, which can induce a -1 nucleotide frame-shift. ORF1 encodes a shorter isoform with a CCHC-type zinc finger motif containing a sequence characteristic of gag proteins of most retroviruses and some retrotransposons. The longer isoform is the result of -1 translational frame-shifting leading to translation of a gag/pol-like protein combining RF1 and RF2. It contains the active-site consensus sequence of the protease domain of pol proteins. Additional isoforms resulting from alternatively spliced transcript variants, as well as from use of upstream non-AUG (CUG) start codon, have been reported for this gene.
Product Categories/Family for anti-PEG10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80kDa
NCBI Official Full Name
retrotransposon-derived protein PEG10 isoform 1
NCBI Official Synonym Full Names
paternally expressed 10
NCBI Official Symbol
PEG10
NCBI Official Synonym Symbols
EDR; HB-1; Mar2; RTL2; MEF3L; Mart2; RGAG3; SIRH1
NCBI Protein Information
retrotransposon-derived protein PEG10
UniProt Protein Name
Retrotransposon-derived protein PEG10
UniProt Gene Name
PEG10
UniProt Synonym Gene Names
EDR; KIAA1051; MAR2; MART2; MEF3L1; RGAG3; MEF3-like protein 1
UniProt Entry Name
PEG10_HUMAN

NCBI Description

This is a paternally expressed imprinted gene that is thought to have been derived from the Ty3/Gypsy family of retrotransposons. It contains two overlapping open reading frames, RF1 and RF2, and expresses two proteins: a shorter, gag-like protein (with a CCHC-type zinc finger domain) from RF1; and a longer, gag/pol-like fusion protein (with an additional aspartic protease motif) from RF1/RF2 by -1 translational frameshifting (-1 FS). While -1 FS has been observed in RNA viruses and transposons in both prokaryotes and eukaryotes, this gene represents the first example of -1 FS in a eukaryotic cellular gene. This gene is highly conserved across mammalian species and retains the heptanucleotide (GGGAAAC) and pseudoknot elements required for -1 FS. It is expressed in adult and embryonic tissues (most notably in placenta) and reported to have a role in cell proliferation, differentiation and apoptosis. Overexpression of this gene has been associated with several malignancies, such as hepatocellular carcinoma and B-cell lymphocytic leukemia. Knockout mice lacking this gene showed early embryonic lethality with placental defects, indicating the importance of this gene in embryonic development. Additional isoforms resulting from alternatively spliced transcript variants, and use of upstream non-AUG (CUG) start codon have been reported for this gene. [provided by RefSeq, Oct 2014]

Uniprot Description

PEG10: Prevents apoptosis in hepatocellular carcinoma (HCC) cells through interaction with SIAH1, a mediator of apoptosis. May also have a role in cell growth promotion and hepatoma formation. Inhibits the TGF-beta signaling by interacting with the TGF-beta receptor ALK1. When overexpressed, induces the formation of cellular extension, such as filipodia in association with ALK1. Involved at the immediate early stage of adipocyte differentiation. May bind to the 5'-GCCTGTCTTT-3' DNA sequence of the MB1 domain in the myelin basic protein (MBP) promoter. Up-regulated by MYC and dihydrotestosteron (DHT). Interacts with ALK1, SIAH1 and SIAH2. 2 isoforms of the human protein are produced by ribosomal frameshifting.

Protein type: RNA-binding; Cell cycle regulation; Apoptosis; Cell development/differentiation

Chromosomal Location of Human Ortholog: 7q21

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding

Biological Process: apoptosis; cell differentiation; negative regulation of transforming growth factor beta receptor signaling pathway

Research Articles on PEG10

Similar Products

Product Notes

The PEG10 peg10 (Catalog #AAA3210303) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PEG10 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's PEG10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PEG10 peg10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SMMTGRAARW ASAKLERSHY LMHNYPAFMM EMKHVFEDPQ RREVAKRKIR. It is sometimes possible for the material contained within the vial of "PEG10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.