Western Blot (WB)
(Host: RabbitTarget Name: PDZK1Sample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse PDZK1 Polyclonal Antibody | anti-PDZK1 antibody
PDZK1 Antibody - middle region
Gene Names
Pdzk1; Pdzd1; mPDZK1; NHERF-3; AI267131; AI314638; AL022680; naPi-Cap1; D3Ertd537e; 1700023D20Rik; 2610507N21Rik; 4921513F16Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
PDZK1; Polyclonal Antibody; PDZK1 Antibody - middle region; anti-PDZK1 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEVVEKVTKSGSRIMFLLVDKETARCHSEQKTQFKRETASLKLLPHQPRV
Sequence Length
519
Applicable Applications for anti-PDZK1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse PDZK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PDZK1Sample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PDZK1Sample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PDZK1 antibody
A scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. May be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins. May play a role in the cellular mechanisms associated with multidrug resistance through its interaction with ABCC2 and PDZK1IP1. May potentiate the CFTR chloride channel activity (By similarity). Required for normal cell-surface expression of SCARB1. Plays a role in maintaining normal plasma cholesterol levels via its effects on SCARB1. Plays a role in the normal localization and function of the chloride-anion exchanger SLC26A6 to the plasma membrane in the brush border of the proximal tubule of the kidney. May be involved in the regulation of proximal tubular Na+-dependent inorganic phosphate cotransport therefore playing an important role in tubule function.
Product Categories/Family for anti-PDZK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57 kDa
NCBI Official Full Name
Na(+)/H(+) exchange regulatory cofactor NHE-RF3
NCBI Official Synonym Full Names
PDZ domain containing 1
NCBI Official Symbol
Pdzk1
NCBI Official Synonym Symbols
Pdzd1; mPDZK1; NHERF-3; AI267131; AI314638; AL022680; naPi-Cap1; D3Ertd537e; 1700023D20Rik; 2610507N21Rik; 4921513F16Rik
NCBI Protein Information
Na(+)/H(+) exchange regulatory cofactor NHE-RF3
UniProt Protein Name
Na(+)/H(+) exchange regulatory cofactor NHE-RF3
Protein Family
UniProt Gene Name
Pdzk1
UniProt Synonym Gene Names
Cap70; Nherf3; NHERF-3; NaPi-Cap1
UniProt Entry Name
NHRF3_MOUSE
Research Articles on PDZK1
Similar Products
Product Notes
The PDZK1 pdzk1 (Catalog #AAA3223691) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDZK1 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PDZK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDZK1 pdzk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEVVEKVTKS GSRIMFLLVD KETARCHSEQ KTQFKRETAS LKLLPHQPRV. It is sometimes possible for the material contained within the vial of "PDZK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
