Rabbit anti-Human PDX1 Polyclonal Antibody | anti-PDX1 antibody

PDX1 (Pancreas/Duodenum Homeobox Protein 1, PDX-1, Glucose-sensitive Factor, GSF, Insulin Promoter Factor 1, IPF-1, Insulin Upstream Factor 1, IUF-1, Islet/Duodenum Homeobox-1, IDX-1, Somatostatin-transactivating Factor 1, STF-1, IPF1, STF1) (AP)

Cat. Num. AAA6388954

• Gene Names: PDHX; E3BP; OPDX; PDX1; proX; DLDBP; PDHXD
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PDX1; Polyclonal Antibody; PDX1 (Pancreas/Duodenum Homeobox Protein 1; PDX-1; Glucose-sensitive Factor; GSF; Insulin Promoter Factor 1; IPF-1; Insulin Upstream Factor 1; IUF-1; Islet/Duodenum Homeobox-1; IDX-1; Somatostatin-transactivating Factor 1; STF-1; IPF1; STF1) (AP); anti-PDX1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PDHX.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 2250

• Applicable Applications for anti-PDX1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PDHX, aa1-501 (AAH10389.1).
• Immunogen Sequence: MAASWRLGCDPRLLRYLVGFPGRRSVGLVKGALGWSVSRGANWRWFHSTQWLRGDPIKILMPSLSPTMEEGNIVKWLKKEGEAVSAGDALCEIETDKAVVTLDASDDGILAKIVVEEGSKNIRLGSLIGLIVEEGEDWKHVEIPKDVGPPPPVSKPSEPRPSPEPQISIPVKKEHIPGTLRFRLSPAARNILEKHSLDASQGTATGPRGIFTKEDALKLVQLKQTGKITESRPTPAPTATPTAPSPLQATAGPSYPRPVIPPVSTPGQPNAVGTFTEIPASNIRRVIAKRLTESKSTVPHAYATADCDLGAVLKVRQDLVKDDIKVSVNDFIIKAAAVTLKQMPDVNVSWDGEGPKQLPFIDISVAVATVKGLLTPIIKDAAAKGIQEIADSVKALSKKARDGKLLPEEYQGGSFSISNLGMFGIDEFTAVINPPQACILAVGRFRPVLKLTEDEEGNAKLQQRQLITVTMSSDSRVVDDELATRFLKSFKANLENPIRLA
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(PDHX rabbit polyclonal antibody. Western Blot analysis of PDHX expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of PDHX expression in transfected 293T cell line by PDHX polyclonal antibody. Lane 1: PDHX transfected lysate (54.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PDX1 antibody

PDX1, also known as Pancreas/duodenum homeobox protein 1, is a nuclear protein belonging to the Antp homeobox family and IPF1/XlHbox-8 subfamily with a homeobox DNA-binding domain. It activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription and is particularly involved in glucose-dependent regulation of insulin gene transcription. During development, PDX1 specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. Expression is common in duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells). Defects in PDX1 are associated with pancreatic agenesis, maturity onset diabetes noninsulin-dependent diabetes mellitus (NIDDM), also known as diabetes mellitus type II, and maturity onset diabetes of the young type 4 (MODY4).

Product Categories/Family for anti-PDX1 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 14714513
• NCBI GeneID: 8050
• NCBI Official Full Name: Homo sapiens pyruvate dehydrogenase complex, component X, mRNA
• NCBI Official Synonym Full Names: pyruvate dehydrogenase complex component X
• NCBI Official Symbol: PDHX
• NCBI Official Synonym Symbols: E3BP; OPDX; PDX1; proX; DLDBP; PDHXD
• NCBI Protein Information: pyruvate dehydrogenase protein X component, mitochondrial
• Protein Family: Pyridoxal 5'-phosphate synthase

NCBI Description

The pyruvate dehydrogenase (PDH) complex is located in the mitochondrial matrix and catalyzes the conversion of pyruvate to acetyl coenzyme A. The PDH complex thereby links glycolysis to Krebs cycle. The PDH complex contains three catalytic subunits, E1, E2, and E3, two regulatory subunits, E1 kinase and E1 phosphatase, and a non-catalytic subunit, E3 binding protein (E3BP). This gene encodes the E3 binding protein subunit; also known as component X of the pyruvate dehydrogenase complex. This protein tethers E3 dimers to the E2 core of the PDH complex. Defects in this gene are a cause of pyruvate dehydrogenase deficiency which results in neurological dysfunction and lactic acidosis in infancy and early childhood. This protein is also a minor antigen for antimitochondrial antibodies. These autoantibodies are present in nearly 95% of patients with the autoimmune liver disease primary biliary cirrhosis (PBC). In PBC, activated T lymphocytes attack and destroy epithelial cells in the bile duct where this protein is abnormally distributed and overexpressed. PBC eventually leads to cirrhosis and liver failure. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2009]