Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PDX1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PDX1 Polyclonal Antibody | anti-PDX1 antibody

PDX1 Antibody - middle region

Gene Names
PDX1; GSF; IPF1; IUF1; IDX-1; MODY4; PDX-1; STF-1; PAGEN1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PDX1; Polyclonal Antibody; PDX1 Antibody - middle region; anti-PDX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPP
Sequence Length
283
Applicable Applications for anti-PDX1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PDX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PDX1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PDX1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PDX1 antibody
The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
pancreas/duodenum homeobox protein 1
NCBI Official Synonym Full Names
pancreatic and duodenal homeobox 1
NCBI Official Symbol
PDX1
NCBI Official Synonym Symbols
GSF; IPF1; IUF1; IDX-1; MODY4; PDX-1; STF-1; PAGEN1
NCBI Protein Information
pancreas/duodenum homeobox protein 1
UniProt Protein Name
Pancreas/duodenum homeobox protein 1
UniProt Gene Name
PDX1
UniProt Synonym Gene Names
IPF1; STF1; PDX-1; GSF; IPF-1; IUF-1; IDX-1; STF-1
UniProt Entry Name
PDX1_HUMAN

NCBI Description

The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (IDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq, Aug 2017]

Uniprot Description

PDX1: Activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription. Particularly involved in glucose-dependent regulation of insulin gene transcription. Binds preferentially the DNA motif 5'-[CT]TAAT[TG]-3'. During development, specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. At adult stage, required for maintaining the hormone-producing phenotype of the beta-cell. Interacts with the basic helix-loop-helix domains of TCF3(E47) and NEUROD1 and with HMG-I(Y). Interacts with SPOP. Interacts with the methyltransferase SETD7. Duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells). Belongs to the Antp homeobox family. IPF1/XlHbox-8 subfamily.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 13q12.1

Cellular Component: nucleus; cytosol

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein heterodimerization activity; protein complex binding; chromatin binding; transcription factor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; response to nicotine; central nervous system development; response to glucocorticoid stimulus; exocrine pancreas development; negative regulation of transcription from RNA polymerase II promoter; glucose homeostasis; response to chlorate; response to vitamin; negative regulation of cell proliferation; detection of glucose; morphogenesis of embryonic epithelium; positive regulation of cell proliferation; response to wounding; response to iron(II) ion; positive regulation of DNA binding; response to drug; organ regeneration; smoothened signaling pathway; generation of precursor metabolites and energy; organ senescence; positive regulation of insulin secretion; glucose metabolic process; stem cell differentiation; liver development; endocrine pancreas development; organ morphogenesis; response to leucine; gut development; insulin secretion; response to cytokine stimulus; positive regulation of transcription from RNA polymerase II promoter; nitric oxide mediated signal transduction

Disease: Maturity-onset Diabetes Of The Young, Type 4; Diabetes Mellitus, Permanent Neonatal; Pancreatic Agenesis 1; Diabetes Mellitus, Noninsulin-dependent

Research Articles on PDX1

Similar Products

Product Notes

The PDX1 pdx1 (Catalog #AAA3223102) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDX1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDX1 pdx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FQNRRMKWKK EEDKKRGGGT AVGGGGVAEP EQDCAVTSGE ELLALPPPPP. It is sometimes possible for the material contained within the vial of "PDX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.