Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- PDK4 Picoband antibody, MBS178182, Western blottingAll lanes: Anti PDK4 (MBS178182) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Mouse Thymus Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 46KDObserved bind size: 46KD )

PDK4 Polyclonal Antibody | anti-PDK4 antibody

Anti-PDK4 Antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
PDK4; Polyclonal Antibody; Anti-PDK4 Antibody; [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4; [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4; FLJ40832; mitochondrial; Pdk4; PDK4_HUMAN; Pyruvate dehydrogenase [lipoamide] kinase isozyme 4 mitochondrial; Pyruvate dehydrogenase kinase 4; Pyruvate dehydrogenase kinase isoenzyme 4; Pyruvate dehydrogenase kinase isoform 4; Pyruvate dehydrogenase kinase isozyme 4; Pyruvate dehydrogenase kinase isozyme 4 mitochondrial; pyruvate dehydrogenase kinase; isozyme 4; anti-PDK4 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
411
Applicable Applications for anti-PDK4 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human PDK4 (91-125aa WYIQSLMDLVEFHEKSPDDQKALSDFVDTLIKVRN), different from the related mouse and rat sequences by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- PDK4 Picoband antibody, MBS178182, Western blottingAll lanes: Anti PDK4 (MBS178182) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Mouse Thymus Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 46KDObserved bind size: 46KD )

Western Blot (WB) (Anti- PDK4 Picoband antibody, MBS178182, Western blottingAll lanes: Anti PDK4 (MBS178182) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Mouse Thymus Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugPredicted bind size: 46KDObserved bind size: 46KD )
Related Product Information for anti-PDK4 antibody
Description: Rabbit IgG polyclonal antibody for [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial(PDK4) detection. Tested with WB in Human;Mouse;Rat.

Background: Pyruvate dehydrogenase lipoamide kinase isozyme 4, mitochondrial is an enzyme that in humans is encoded by the PDK4 gene. This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin. In addition, PDK4 is increased in hibernation and helps to decrease metabolism and conserve glucose by decreasing its conversion to acetyl-CoA, which enters the citric acid cycle and is converted to ATP.
References
1. "Entrez Gene: PDK4 pyruvate dehydrogenase kinase, isozyme 4". 2. Andrews MT, Squire TL, Bowen CM, Rollins MB (Jul 1998). "Low-temperature carbon utilization is regulated by novel gene activity in the heart of a hibernating mammal". Proceedings of the National Academy of Sciences of the United States of America 95 (14): 8392-7. 3. Gudi R, Bowker-Kinley MM, Kedishvili NY, Zhao Y, Popov KM (Dec 1995). "Diversity of the pyruvate dehydrogenase kinase gene family in humans".The Journal of Biological Chemistry 270 (48): 28989-94.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,469 Da
NCBI Official Full Name
pyruvate dehydrogenase kinase, isozyme 4
NCBI Official Synonym Full Names
pyruvate dehydrogenase kinase 4
NCBI Official Symbol
PDK4
NCBI Protein Information
pyruvate dehydrogenase kinase, isozyme 4
UniProt Protein Name
[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial
UniProt Gene Name
PDK4
UniProt Synonym Gene Names
PDHK4
UniProt Entry Name
PDK4_HUMAN

NCBI Description

This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin. [provided by RefSeq, Jul 2008]

Uniprot Description

PDHK4: an ubiquitously expressed, atypical protein kinase associated with the mitochondrial matrix. The PDHKs play crucial roles in switching metabolic flux from oxidative phosphorylation towards glycolysis. PDHK4 is abundant in heart, skeletal muscle, kidney, and pancreatic islets. Contains a HATPase_c catalytic domain, found in several ATP-binding proteins including protein histidine kinases (PHKs), PHDKs, DNA gyrase B, topoisomerases, heat shock proteins, and DNA mismatch repair proteins. PDHK regulates glucose oxidation through inhibitory phosphorylation of the E1 alpha subunit of the mitochondrial pyruvate dehydrogenase complex (PDHC) at any one of 3 inhibitory serine residues. Inhibitory sites 1, 2, and 3 correspond to S293, S300, and S232 in human PDHA1, respectively. Four PDHK isoenzymes have been described, each with different site specificity: all four phosphorylate sites 1 and 2 but at different rates; for site 1 PDHK2 >PDHK4 >PDHK1 >PDHK3; for site 2, PDHK3> PDHK4 > PDHK2 > PDHK1. Only PDHK1 phosphorylates site 3. PDHKs are recruited to the PDHC by binding to a lipoyl group covalently attached to the inner lipoyl domain of the E2 component. PDHA1 deficiency is the most common enzyme defect in patients with primary lactic acidosis. Suppression of PDH by PDHK inhibits the conversion of pyruvate to acetyl-CoA, attenuates mitochondrial respiration, and may contribute to the increased lactate production observed in many tumors. The PDH pathway is repressed in a majority of non-small cell lung carcinomas. Inhibited by AZD7545, dichloroacetate (DCA), and radicicol. Radicicol inhibits kinase activity by binding directly to the ATP-binding pocket of PDHK, similar to HSP90 from the same ATPase/kinase superfamily.

Protein type: EC 2.7.11.2; Protein kinase, atypical; Kinase, protein; Mitochondrial; ATYPICAL group; PDHK family

Chromosomal Location of Human Ortholog: 7q21.3

Cellular Component: mitochondrial inner membrane; mitochondrial matrix; mitochondrion

Molecular Function: ATP binding; protein kinase activity; pyruvate dehydrogenase (acetyl-transferring) kinase activity

Biological Process: cellular response to starvation; glucose homeostasis; glucose metabolic process; insulin receptor signaling pathway; positive regulation of defense response to virus by host; protein amino acid phosphorylation; regulation of acetyl-CoA biosynthetic process from pyruvate; regulation of bone resorption; regulation of fatty acid biosynthetic process; regulation of fatty acid oxidation; regulation of pH; response to starvation

Research Articles on PDK4

Similar Products

Product Notes

The PDK4 pdk4 (Catalog #AAA178182) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-PDK4 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDK4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the PDK4 pdk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PDK4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.