Rabbit anti-Human, Mouse PDIA5 Polyclonal Antibody | anti-PDIA5 antibody
PDIA5 Polyclonal Antibody
Gene Names
PDIA5; PDIR
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PDIA5; Polyclonal Antibody; PDIA5 Polyclonal Antibody; PDIR; anti-PDIA5 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
SSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKSIVAFLKDPKG
Sequence Length
519
Applicable Applications for anti-PDIA5 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human PDIA5
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Endoplasmic reticulum lumen
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-PDIA5 antibody
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, three catalytically active thioredoxin (TRX) domains, a TRX-like domain, and a C-terminal ER-retention sequence. The N-terminal TRX-like domain is the primary binding site for the major ER chaperone calreticulin and possibly other proteins and substrates as well. Alternative splicing results in multiple protein- and non-protein-coding transcript variants.
Product Categories/Family for anti-PDIA5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30kDa/59kDa
NCBI Official Full Name
protein disulfide-isomerase A5
NCBI Official Synonym Full Names
protein disulfide isomerase family A member 5
NCBI Official Symbol
PDIA5
NCBI Official Synonym Symbols
PDIR
NCBI Protein Information
protein disulfide-isomerase A5
UniProt Protein Name
Protein disulfide-isomerase A5
Protein Family
UniProt Gene Name
PDIA5
UniProt Synonym Gene Names
PDIR
NCBI Description
This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, three catalytically active thioredoxin (TRX) domains, a TRX-like domain, and a C-terminal ER-retention sequence. The N-terminal TRX-like domain is the primary binding site for the major ER chaperone calreticulin and possibly other proteins and substrates as well. Alternative splicing results in multiple protein- and non-protein-coding transcript variants. [provided by RefSeq, Dec 2016]
Research Articles on PDIA5
Similar Products
Product Notes
The PDIA5 pdia5 (Catalog #AAA9134479) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDIA5 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PDIA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the PDIA5 pdia5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SSAKVSSLIE RISDPKDLKK LLRTRNNVLV LYSKSEVAAE NHLRLLSTVA QAVKGQGTIC WVDCGDAESR KLCKKMKVDL SPKDKKVELF HYQDGAFHTE YNRAVTFKSI VAFLKDPKG. It is sometimes possible for the material contained within the vial of "PDIA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
