Immunohistochemistry (IHC)
(Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :PDIA3: Red DAPI:BlueGene Name :PDIA3Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Rabbit PDIA3 Polyclonal Antibody | anti-PDIA3 antibody
PDIA3 antibody - C-terminal region
Gene Names
PDIA3; P58; ER60; ERp57; ERp60; ERp61; GRP57; GRP58; PI-PLC; HsT17083; HEL-S-269; HEL-S-93n
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Affinity Purified
Synonyms
PDIA3; Polyclonal Antibody; PDIA3 antibody - C-terminal region; anti-PDIA3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVIQEEKPKKKKKAQE
Sequence Length
505
Applicable Applications for anti-PDIA3 antibody
Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 100%; Sheep: 93%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :PDIA3: Red DAPI:BlueGene Name :PDIA3Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Immunohistochemistry (IHC)
(Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :PDIA3: Red DAPI:BlueGene Name :PDIA3Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-PDIA3 antibody
This is a rabbit polyclonal antibody against PDIA3. It was validated on Western Blot
Target Description: This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.
Target Description: This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.
Product Categories/Family for anti-PDIA3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
protein disulfide-isomerase A3
NCBI Official Synonym Full Names
protein disulfide isomerase family A member 3
NCBI Official Symbol
PDIA3
NCBI Official Synonym Symbols
P58; ER60; ERp57; ERp60; ERp61; GRP57; GRP58; PI-PLC; HsT17083; HEL-S-269; HEL-S-93n
NCBI Protein Information
protein disulfide-isomerase A3
UniProt Protein Name
Protein disulfide-isomerase A3
Protein Family
UniProt Gene Name
PDIA3
UniProt Synonym Gene Names
ERP57; ERP60; GRP58; p58; ER protein 57; ERp57; ER protein 60; ERp60
UniProt Entry Name
PDIA3_HUMAN
NCBI Description
This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates. This protein also functions as a molecular chaperone that prevents the formation of protein aggregates. [provided by RefSeq, Dec 2016]
Research Articles on PDIA3
Similar Products
Product Notes
The PDIA3 pdia3 (Catalog #AAA3216085) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDIA3 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PDIA3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). Researchers should empirically determine the suitability of the PDIA3 pdia3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YFSPANKKLN PKKYEGGREL SDFISYLQRE ATNPPVIQEE KPKKKKKAQE. It is sometimes possible for the material contained within the vial of "PDIA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
