Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit PDE9A Polyclonal Antibody | anti-PDE9A antibody

PDE9A Antibody

Gene Names
PDE9A; HSPDE9A2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
PDE9A; Polyclonal Antibody; PDE9A Antibody; anti-PDE9A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET
Sequence Length
526
Applicable Applications for anti-PDE9A antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PDE9A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Western Blot (WB)

(Host: RabbitTarget Name: PDE9ASample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PDE9ASample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Sample Type :Lane 1: 5ug in vitro translation without DNA Lane 2: 5ug in vitro translation hNeur1-pcDNA3 Lane 3: 60ug in vitro translation rNeur1-pcDNA3 Lane 4: 60ug HEK293 cell lysate (not transfected) Lane 5: 60ug hNeur1-pcDNA3 overexpressed in HEK293 cells Lane 6: 60ug rNeur1-pcDNA3 overexpressed in HEK293 cells Primary Antibody Dilution :1:1000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:5000 Color/Signal Descriptions:PDE9A Gene Name:Kati Taal and Richard Tamme, Department of Gene Technology, Tallinn University of Technology. Submitted by:)

Western Blot (WB) (Sample Type :Lane 1: 5ug in vitro translation without DNA Lane 2: 5ug in vitro translation hNeur1-pcDNA3 Lane 3: 60ug in vitro translation rNeur1-pcDNA3 Lane 4: 60ug HEK293 cell lysate (not transfected) Lane 5: 60ug hNeur1-pcDNA3 overexpressed in HEK293 cells Lane 6: 60ug rNeur1-pcDNA3 overexpressed in HEK293 cells Primary Antibody Dilution :1:1000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:5000 Color/Signal Descriptions:PDE9A Gene Name:Kati Taal and Richard Tamme, Department of Gene Technology, Tallinn University of Technology. Submitted by:)

Western Blot (WB)

(WB Suggested Anti-PDE9A Antibody Titration: 1.0 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-PDE9A Antibody Titration: 1.0 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB)

(WB Suggested Anti-PDE9A Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: Mouse Brain lysate)

Western Blot (WB) (WB Suggested Anti-PDE9A Antibody Titration: 5% MilkELISA Titer: dilution: 1:500Positive Control: Mouse Brain lysate)
Related Product Information for anti-PDE9A antibody
This is a rabbit polyclonal antibody against PDE9A. It was validated on Western Blot and immunohistochemistry

Target Description: PDE9A catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides.The protein encoded by this gene catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The encoded protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides. Multiple transcript variants encoding several different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A isoform m
NCBI Official Synonym Full Names
phosphodiesterase 9A
NCBI Official Symbol
PDE9A
NCBI Official Synonym Symbols
HSPDE9A2
NCBI Protein Information
high affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
UniProt Protein Name
High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
UniProt Gene Name
PDE9A
UniProt Entry Name
PDE9A_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the hydrolysis of cAMP and cGMP to their corresponding monophosphates. The encoded protein plays a role in signal transduction by regulating the intracellular concentration of these cyclic nucleotides. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on PDE9A

Similar Products

Product Notes

The PDE9A pde9a (Catalog #AAA3207904) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDE9A Antibody reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PDE9A can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PDE9A pde9a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDIKKMREEL AARSSRTNCP CKYSFLDNHK KLTPRRDVPT YPKYLLSPET. It is sometimes possible for the material contained within the vial of "PDE9A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.