Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using PDE4D antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Rabbit anti-Human PDE4D Polyclonal Antibody | anti-PDE4D antibody

PDE4D Polyclonal Antibody

Gene Names
PDE4D; DPDE3; PDE43; STRK1; ACRDYS2; HSPDE4D; PDE4DN2
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purification
Synonyms
PDE4D; Polyclonal Antibody; PDE4D Polyclonal Antibody; ACRDYS2; DPDE3; HSPDE4D; PDE43; PDE4DN2; STRK1; anti-PDE4D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
FKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVGEEEE
Sequence Length
809
Applicable Applications for anti-PDE4D antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IF: 1:20 - 1:100
Immunogen
Recombinant protein of human PDE4D
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Apical cell membrane, Cytoplasm, Membrane, centrosome, cytoskeleton, microtubule organizing center
Positive Samples
HT-29, A-549, SW480
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using PDE4D antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using PDE4D antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-PDE4D antibody
This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins.
Product Categories/Family for anti-PDE4D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 23-24kDa; 57-91kDa
Observed: 110kDa
NCBI Official Full Name
cAMP-specific 3',5'-cyclic phosphodiesterase 4D isoform PDE4D4
NCBI Official Synonym Full Names
phosphodiesterase 4D
NCBI Official Symbol
PDE4D
NCBI Official Synonym Symbols
DPDE3; PDE43; STRK1; ACRDYS2; HSPDE4D; PDE4DN2
NCBI Protein Information
cAMP-specific 3',5'-cyclic phosphodiesterase 4D
UniProt Protein Name
cAMP-specific 3',5'-cyclic phosphodiesterase 4D
UniProt Gene Name
PDE4D
UniProt Synonym Gene Names
DPDE3

NCBI Description

This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteins.[provided by RefSeq, Sep 2009]

Uniprot Description

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.

Research Articles on PDE4D

Similar Products

Product Notes

The PDE4D pde4d (Catalog #AAA9133948) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDE4D Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDE4D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500 - 1:2000 IF: 1:20 - 1:100. Researchers should empirically determine the suitability of the PDE4D pde4d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FKLLQEENCD IFQNLTKKQR QSLRKMVIDI VLATDMSKHM NLLADLKTMV ETKKVTSSGV LLLDNYSDRI QVLQNMVHCA DLSNPTKPLQ LYRQWTDRIM EEFFRQGDRE RERGMEISPM CDKHNASVEK SQVGFIDYIV HPLWETWADL VHPDAQDILD TLEDNREWYQ STIPQSPSPA PDDPEEGRQG QTEKFQFELT LEEDGESDTE KDSGSQVEED TSCSDSKTLC TQDSESTEIP LDEQVEEEAV GEEEE. It is sometimes possible for the material contained within the vial of "PDE4D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.