Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PDE1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: HT1080 cell lysate)

Rabbit PDE1B Polyclonal Antibody | anti-PDE1B antibody

PDE1B antibody - middle region

Gene Names
PDE1B; PDE1B1; PDES1B; HEL-S-79p
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDE1B; Polyclonal Antibody; PDE1B antibody - middle region; anti-PDE1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNL
Sequence Length
536
Applicable Applications for anti-PDE1B antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PDE1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PDE1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-PDE1B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: HT1080 cell lysate)
Related Product Information for anti-PDE1B antibody
This is a rabbit polyclonal antibody against PDE1B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PDE1B has a preference for cGMP as a substrate.
Product Categories/Family for anti-PDE1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B isoform 1
NCBI Official Synonym Full Names
phosphodiesterase 1B
NCBI Official Symbol
PDE1B
NCBI Official Synonym Symbols
PDE1B1; PDES1B; HEL-S-79p
NCBI Protein Information
calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
UniProt Protein Name
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
UniProt Gene Name
PDE1B
UniProt Synonym Gene Names
PDE1B1; PDES1B; Cam-PDE 1B
UniProt Entry Name
PDE1B_HUMAN

NCBI Description

The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]

Uniprot Description

PDE1B: Cyclic nucleotide phosphodiesterase with a dual- specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a preference for cGMP as a substrate. Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.4.17; Nucleotide Metabolism - purine; Phosphodiesterase; Apoptosis

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: cell soma; cytosol

Molecular Function: calmodulin binding; 3',5'-cyclic-AMP phosphodiesterase activity; calmodulin-dependent cyclic-nucleotide phosphodiesterase activity; calcium- and calmodulin-regulated 3',5'-cyclic-GMP phosphodiesterase activity; metal ion binding

Biological Process: epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; nerve growth factor receptor signaling pathway; monocyte differentiation; apoptosis; regulation of neurotransmitter levels; response to amphetamine; cAMP catabolic process; regulation of dopamine metabolic process; locomotory behavior; signal transduction; phospholipase C activation; innate immune response; visual learning; cGMP catabolic process; blood coagulation; serotonin metabolic process

Research Articles on PDE1B

Similar Products

Product Notes

The PDE1B pde1b (Catalog #AAA3224460) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDE1B antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDE1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDE1B pde1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKRIQENKQK WKERAASGIT NQMSIDELSP CEEEAPPSPA EDEHNQNGNL. It is sometimes possible for the material contained within the vial of "PDE1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.