Western Blot (WB)
(Host: RabbitTarget Name: PDE11ASample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human PDE11A Polyclonal Antibody | anti-PDE11A antibody
PDE11A Antibody - N-terminal region
Gene Names
PDE11A; PPNAD2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PDE11A; Polyclonal Antibody; PDE11A Antibody - N-terminal region; anti-PDE11A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGSRGDGNLQRRASQKELRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVR
Sequence Length
933
Applicable Applications for anti-PDE11A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PDE11A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PDE11ASample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PDE11ASample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PDE11A antibody
The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3',5'-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5'-monophosphates and provide a mechanism to downregulate cAMP and cGMP signaling. This gene encodes a member of the PDE protein superfamily. Mutations in this gene are a cause of Cushing disease and adrenocortical hyperplasia. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PDE11A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102 kDa
NCBI Official Full Name
dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A isoform 1
NCBI Official Synonym Full Names
phosphodiesterase 11A
NCBI Official Symbol
PDE11A
NCBI Official Synonym Symbols
PPNAD2
NCBI Protein Information
dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
UniProt Protein Name
Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A
Protein Family
UniProt Gene Name
PDE11A
UniProt Entry Name
PDE11_HUMAN
NCBI Description
The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3',5'-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5'-monophosphates and provide a mechanism to downregulate cAMP and cGMP signaling. This gene encodes a member of the PDE protein superfamily. Mutations in this gene are a cause of Cushing disease and adrenocortical hyperplasia. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Research Articles on PDE11A
Similar Products
Product Notes
The PDE11A pde11a (Catalog #AAA3221709) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDE11A Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDE11A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDE11A pde11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGSRGDGNLQ RRASQKELRK SFARSKAIHV NRTYDEQVTS RAQEPLSSVR. It is sometimes possible for the material contained within the vial of "PDE11A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
