Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PDCD7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

Rabbit PDCD7 Polyclonal Antibody | anti-PDCD7 antibody

PDCD7 antibody - middle region

Gene Names
PDCD7; ES18; HES18
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDCD7; Polyclonal Antibody; PDCD7 antibody - middle region; anti-PDCD7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT
Sequence Length
485
Applicable Applications for anti-PDCD7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PDCD7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PDCD7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-PDCD7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)
Related Product Information for anti-PDCD7 antibody
This is a rabbit polyclonal antibody against PDCD7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PDCD7 is a protein with sequence similarity to a mouse protein originally identified in embryonic stem cells. In mouse T-cell lines, this protein appears to be related to glucocorticoid- and staurine-induced apoptotic pathways, and to be linked to ceramid
Product Categories/Family for anti-PDCD7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
programmed cell death protein 7
NCBI Official Synonym Full Names
programmed cell death 7
NCBI Official Symbol
PDCD7
NCBI Official Synonym Symbols
ES18; HES18
NCBI Protein Information
programmed cell death protein 7
UniProt Protein Name
Programmed cell death protein 7
UniProt Gene Name
PDCD7
UniProt Synonym Gene Names
hES18
UniProt Entry Name
PDCD7_HUMAN

NCBI Description

This gene encodes a 59 kDa protein that is associated with the U11 small nuclear ribonucleoprotein (snRNP), which is a component of the minor U12-type spliceosome responsible for catalyzing pre-mRNA splicing of U12-type introns. [provided by RefSeq, Dec 2010]

Uniprot Description

Function: Promotes apoptosis when overexpressed

By similarity.

Subunit structure: Interacts with RBM40. Component of the U11/U12 snRNPs that are part of the U12-type spliceosome. Ref.5 Ref.6

Subcellular location: Nucleus

Potential.

Research Articles on PDCD7

Similar Products

Product Notes

The PDCD7 pdcd7 (Catalog #AAA3214050) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDCD7 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDCD7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDCD7 pdcd7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YLQAEHSLPA LIQIRHDWDQ YLVPSDHPKG NFVPQGWVLP PLPSNDIWAT. It is sometimes possible for the material contained within the vial of "PDCD7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.