Rabbit anti-Human PDCD6 Polyclonal Antibody | anti-PDCD6 antibody

PDCD6 Antibody - middle region

Cat. Num. AAA3220519

• Gene Names: PDCD6; ALG2; ALG-2; PEF1B
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: PDCD6; Polyclonal Antibody; PDCD6 Antibody - middle region; anti-PDCD6 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNE
• Sequence Length: 167

• Applicable Applications for anti-PDCD6 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDCD6
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PDCD6Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-PDCD6 antibody

This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T cell receptor-, Fas-, and glucocorticoid-induced programmed cell death. In mice deficient for this gene product, however, apoptosis was not blocked suggesting this gene product is functionally redundant. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is also located on the short arm of chromosome 5.

Product Categories/Family for anti-PDCD6 antibody

Polyclonal

NCBI and Uniprot Product Information

• NCBI GI #: 389565483
• NCBI GeneID: 10016
• NCBI Accession #: NP_001254485.1
• NCBI GenBank Nucleotide #: NM_001267556.1
• UniProt Accession #: O75340
• Molecular Weight: 22 kDa
• NCBI Official Full Name: programmed cell death protein 6 isoform 2
• NCBI Official Synonym Full Names: programmed cell death 6
• NCBI Official Symbol: PDCD6
• NCBI Official Synonym Symbols: ALG2; ALG-2; PEF1B
• NCBI Protein Information: programmed cell death protein 6
• UniProt Protein Name: Programmed cell death protein 6
• Protein Family: Programmed cell death protein
• UniProt Gene Name: PDCD6
• UniProt Synonym Gene Names: ALG2
• UniProt Entry Name: PDCD6_HUMAN

NCBI Description

This gene encodes a calcium-binding protein belonging to the penta-EF-hand protein family. Calcium binding is important for homodimerization and for conformational changes required for binding to other protein partners. This gene product participates in T cell receptor-, Fas-, and glucocorticoid-induced programmed cell death. In mice deficient for this gene product, however, apoptosis was not blocked suggesting this gene product is functionally redundant. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is also located on the short arm of chromosome 5. [provided by RefSeq, May 2012]

Uniprot Description

PDCD6: Calcium-binding protein required for T-cell receptor-, Fas-, and glucocorticoid-induced cell death. May mediate Ca(2+)- regulated signals along the death pathway. Calcium-dependent adapter necessary for the association between PDCD6IP and TSG101. Interaction with DAPK1 can accelerate apoptotic cell death by increasing caspase-3 activity.

Chromosomal Location of Human Ortholog: 5p15.33

Cellular Component: endoplasmic reticulum membrane; nuclear membrane; endoplasmic reticulum; cytoplasm; cytoplasmic vesicle; nucleus; endosome

Molecular Function: protein dimerization activity; protein binding; protein homodimerization activity; protein anchor; calcium-dependent cysteine-type endopeptidase activity; calcium ion binding; calcium-dependent protein binding; molecular adaptor activity

Biological Process: caspase activation; intracellular protein transport; negative regulation of TOR signaling pathway; positive regulation of angiogenesis; negative regulation of protein kinase B signaling cascade; negative regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of caspase activity; positive regulation of endothelial cell proliferation; angiogenesis; response to calcium ion; proteolysis