Western Blot (WB)
(PCTP rabbit polyclonal antibody. Western Blot analysis of PCTP expression in HepG2.)
Rabbit anti-Human PCTP Polyclonal Antibody | anti-Pctp antibody
PCTP (STARD2, Phosphatidylcholine Transfer Protein, START Domain-containing Protein 2, StAR-related Lipid Transfer Protein 2)
Gene Names
Pctp; PC-TP; StarD2
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PCTP; Polyclonal Antibody; PCTP (STARD2; Phosphatidylcholine Transfer Protein; START Domain-containing Protein 2; StAR-related Lipid Transfer Protein 2); Anti -PCTP (STARD2; anti-Pctp antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PCTP.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDSDYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT
Applicable Applications for anti-Pctp antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PCTP, aa1-214 (AAH12084.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(PCTP rabbit polyclonal antibody. Western Blot analysis of PCTP expression in HepG2.)
Western Blot (WB)
(PCTP rabbit polyclonal antibody. Western Blot analysis of PCTP expression in HepG2.)
Western Blot (WB)
(Western Blot analysis of PCTP expression in transfected 293T cell line by PCTP polyclonal antibody. Lane 1: PCTP transfected lysate (24.8kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PCTP expression in transfected 293T cell line by PCTP polyclonal antibody. Lane 1: PCTP transfected lysate (24.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-Pctp antibody
PCTP catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule.
Product Categories/Family for anti-Pctp antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24,785 Da
NCBI Official Full Name
phosphatidylcholine transfer protein
NCBI Official Synonym Full Names
phosphatidylcholine transfer protein
NCBI Official Symbol
Pctp
NCBI Official Synonym Symbols
PC-TP; StarD2
NCBI Protein Information
phosphatidylcholine transfer protein; START domain-containing protein 2; stAR-related lipid transfer protein 2
UniProt Protein Name
Phosphatidylcholine transfer protein
Protein Family
UniProt Gene Name
Pctp
UniProt Synonym Gene Names
Stard2; PC-TP; StARD2
UniProt Entry Name
PPCT_MOUSE
Uniprot Description
PCTP: Catalyzes the transfer of phosphatidylcholine between membranes. Binds a single lipid molecule. 2 isoforms of the human protein are produced by alternative splicing.
Cellular Component: cytoplasm
Molecular Function: phosphatidylcholine transmembrane transporter activity; phosphatidylcholine binding; lipid binding
Biological Process: cholesterol metabolic process; transport; phospholipid transport; lipid transport
Research Articles on Pctp
Similar Products
Product Notes
The Pctp pctp (Catalog #AAA6007654) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PCTP (STARD2, Phosphatidylcholine Transfer Protein, START Domain-containing Protein 2, StAR-related Lipid Transfer Protein 2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PCTP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the Pctp pctp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MELAAGSFSE EQFWEACAEL QQPALAGADW QLLVETSGIS IYRLLDKKTG LYEYKVFGVL EDCSPTLLAD IYMDSDYRKQ WDQYVKELYE QECNGETVVY WEVKYPFPMS NRDYVYLRQR RDLDMEGRKI HVILARSTSM PQLGERSGVI RVKQYKQSLA IESDGKKGSK VFMYYFDNPG GQIPSWLINW AAKNGVPNFL KDMARACQNY LKKT. It is sometimes possible for the material contained within the vial of "PCTP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
